[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56765.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->69 1xxlA PDBj 6e-04 23.5 %
:RPS:PDB   1->123 3e05G PDBj 6e-10 13.4 %
:RPS:SCOP  16->102 2gh1A1  c.66.1.49 * 5e-10 19.5 %
:HMM:SCOP  1->123 1xvaA_ c.66.1.5 * 5.8e-20 30.9 %
:RPS:PFM   1->72 PF01209 * Ubie_methyltran 2e-07 30.6 %
:HMM:PFM   2->65 PF08242 * Methyltransf_12 4.1e-10 28.1 64/99  
:BLT:SWISS 7->74 UBIE_CAMJR 1e-06 33.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56765.1 GT:GENE ACF56765.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1860078..1860458) GB:FROM 1860078 GB:TO 1860458 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF56765.1 GB:DB_XREF GI:194358317 LENGTH 126 SQ:AASEQ MLEQARLKVEQQAIKNIQFLEQDLPKNPLEKEFDCLAVSRVLHHMPDLDAALSLFHQHLKEDGKLIIADFTKTEANHHGFDLAELENKLIEHGFSSVHSQILYSAXDLFQGNHSEFFLIVAQKSLA GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 7->74|UBIE_CAMJR|1e-06|33.8|68/235| BL:PDB:NREP 1 BL:PDB:REP 2->69|1xxlA|6e-04|23.5|68/231| RP:PDB:NREP 1 RP:PDB:REP 1->123|3e05G|6e-10|13.4|119/189| RP:PFM:NREP 1 RP:PFM:REP 1->72|PF01209|2e-07|30.6|72/234|Ubie_methyltran| HM:PFM:NREP 1 HM:PFM:REP 2->65|PF08242|4.1e-10|28.1|64/99|Methyltransf_12| GO:PFM:NREP 1 GO:PFM GO:0008168|"GO:methyltransferase activity"|PF01209|IPR004033| RP:SCP:NREP 1 RP:SCP:REP 16->102|2gh1A1|5e-10|19.5|87/281|c.66.1.49| HM:SCP:REP 1->123|1xvaA_|5.8e-20|30.9|123/292|c.66.1.5|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 18 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------11-----------------------------------------------------------------------------1111---111--------------------------1-----------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------1---1------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 98.4 SQ:SECSTR HHHHHHHHHHHHTcTTEEEEEccTTTTcTcTTcccccEEEEcccTTcHHHHHHHHHHHccTTcEEEEEEccHHHHHHHHHHHHHTTcEEEEEEEccEEccccccccccEEcccccEEEEEEEcc## DISOP:02AL 126-127| PSIPRED cHHHHHHHHHHccccccEEEEccHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHccccEEEEEEEEHHHHHHccccccEEEEEEEHHcc //