[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56773.1
DDBJ      :             Tn5253 conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  70/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.34.19b.84.3d.3.1
:937 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   605->782 3csqA PDBj 3e-08 32.9 %
:BLT:PDB   816->934 2k3aA PDBj 3e-07 37.0 %
:RPS:PDB   497->581 2b13A PDBj 9e-07 23.5 %
:RPS:PDB   583->776 3csrA PDBj 3e-08 27.0 %
:RPS:SCOP  492->579 1qwyA  b.84.3.2 * 5e-08 22.7 %
:RPS:SCOP  857->916 2dk3A1  b.34.19.1 * 1e-14 14.3 %
:HMM:SCOP  793->916 2io8A2 d.3.1.15 * 2.4e-12 28.2 %
:RPS:PFM   382->482 PF06201 * PITH 2e-04 31.5 %
:RPS:PFM   810->926 PF05257 * CHAP 9e-13 47.1 %
:HMM:PFM   804->926 PF05257 * CHAP 1.8e-31 44.5 110/125  
:HMM:PFM   490->556 PF01551 * Peptidase_M23 0.00016 35.5 62/96  
:BLT:SWISS 605->773 VG13_BPPH2 5e-08 35.1 %
:BLT:SWISS 816->929 SSAA2_STAAR 5e-08 43.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56773.1 GT:GENE ACF56773.1 GT:PRODUCT Tn5253 conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1239715..1242528) GB:FROM 1239715 GB:TO 1242528 GB:DIRECTION - GB:PRODUCT Tn5253 conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF01551; match to protein family HMM PF05257 GB:PROTEIN_ID ACF56773.1 GB:DB_XREF GI:194358325 LENGTH 937 SQ:AASEQ MKDKREIIRARKAFRRSLKDEKKFLKQGKKEVRKQKKDSAVLDEKAWKNEIKQKLENMREASKARVKQANEDYNHILQNSPPSLLNRKELRDRRLPHARKRLKIAKKQFKEAKVEAKEERKESRKERKTNQKFFYGQETKVKSNFFLQGKNLEELKAKKEVKAAKENLKSTKQAYKFKKISRKAKTFLYVLGREGGELASENEDLESYRTLHETIRKGKRYSRLSYNLGKASVKTGQATGRFTKKRLTNTKERYHHFKDGKGWKLTKDNPSSFKNRYRKLKKQGLLSVRNIYQKLKGAFSFFTFVAGNPVIWIVGGIVFLLLLMMSFFLGFSSASLIQQDEFELTKAYTHLTWEDAEHTRTNDKGITYYTKVDDVMGYMNFKFHDYELQKPVHLFSSETYKDYLSALWHDLNDGEDLKSMQDLYETPKYKLSKDDQEEIKELKEEGVYASMQELDNPFEGKSNEDSLTMTYRYGYYDLDGKPTLQEYILLEAKAHQTIVAPMDGVVSLDGDDVILTNGKGENESRLTLYSIHNGRAIEGTRVLTGDVIGETPDDTGLKVSYQKYKNKKEKLVYVNPQFYFPKVIQLQTTILPAIGQFGGDEFERAKHIYDFLKSQGASPQAIAAILGNWSVESSINPKRAEGDYLSPPVGATDSSWDDETWLAIGGPAIYSGAYPNILHRGLGLGQWTDTADGSTRHTALLNYARTQNKKWYDLDLQLDFMLHGDSPYYQSWLKDFFKNTGSAANLAQLFLTYWEGNSGDKLLERQTRATEWYYQIEKGFSQTNGGQAKSDPQSLEGVRGDLYEHSVPGGGDGMAYAYGQCTWGVAARMNQLGLKLKGSNGEKISIINTMGNGQDWVATASSLGGETGSTPRXGAIVSFVGXTHGTPAIYGHVAFVEKVYDDGSFLVSETNYGGNPNYTFRKISHADSAISFAYTTK GT:EXON 1|1-937:0| BL:SWS:NREP 2 BL:SWS:REP 605->773|VG13_BPPH2|5e-08|35.1|131/365| BL:SWS:REP 816->929|SSAA2_STAAR|5e-08|43.2|95/269| TM:NTM 1 TM:REGION 306->328| SEG 26->37|kqgkkevrkqkk| SEG 105->128|akkqfkeakveakeerkesrkerk| SEG 150->169|knleelkakkevkaakenlk| SEG 319->336|fllllmmsfflgfssasl| BL:PDB:NREP 2 BL:PDB:REP 605->782|3csqA|3e-08|32.9|140/324| BL:PDB:REP 816->934|2k3aA|3e-07|37.0|100/155| RP:PDB:NREP 2 RP:PDB:REP 497->581|2b13A|9e-07|23.5|85/131| RP:PDB:REP 583->776|3csrA|3e-08|27.0|152/159| RP:PFM:NREP 2 RP:PFM:REP 382->482|PF06201|2e-04|31.5|92/114|PITH| RP:PFM:REP 810->926|PF05257|9e-13|47.1|104/121|CHAP| HM:PFM:NREP 2 HM:PFM:REP 804->926|PF05257|1.8e-31|44.5|110/125|CHAP| HM:PFM:REP 490->556|PF01551|0.00016|35.5|62/96|Peptidase_M23| RP:SCP:NREP 2 RP:SCP:REP 492->579|1qwyA|5e-08|22.7|88/234|b.84.3.2| RP:SCP:REP 857->916|2dk3A1|1e-14|14.3|56/73|b.34.19.1| HM:SCP:REP 793->916|2io8A2|2.4e-12|28.2|110/0|d.3.1.15|1/1|Cysteine proteinases| OP:NHOMO 130 OP:NHOMOORG 70 OP:PATTERN -------------------------------------------------------------------- --------11-------------------------------------------1-----------------2222321------------------------------------------------------------------------------------------------------------------------------------------------------------22222222322222133217-------------------21-1232132111-1----11111--12222222222222-22211312----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 507 STR:RPRED 54.1 SQ:SECSTR ###########################################################################################################################################################################################################################################################################################################################################################HHHHHccccccTTcccGGGGTcccccccEEEcccEEcTTcEEEEEEEEcTTccEEccEEEEEEEccTTcEEccGGGccccccEEccTTcTTEEEEEEEEHHHHcEEEEEEEcccTTTcTTccccEEEEEEEEEEccccccEEEEccTTcEEEccccEEEEEEEEccccccEEETTccEEEEEEEEcccccTTcEEcTTcEEEEcccccccEEEEEEEEccccGGGEEccHHHHccccccccccccHEEcTTHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHcccTT###############TccGG###GccGGGcTTcTT######cccTTTTcccHHH####HHHHHHHHHHTTcccccHHHHHHHHHHHHHHcccccccccHHHcccHHHHHHHHHHHTTcccccccTHHHHHHHHHHHHccccccc#################################ccTTcHHHHHHHHT########TTc#####ccGGGccHHHHHHHHHHHTcEEEccccccEEEE######ccTTccccEEEEEEEcTTccEEEEEEccTTcTTcEEEEEEcHHHHTTcEE### DISOP:02AL 1-4,8-8,16-17,20-62,108-132,153-168,599-599,779-801| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEccHHHHEEEEEEEEEccccccHHHHcccccHHHHHHHHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHccccccccccccEEEEEEEcccccccccccccccEEEEEEcccEEEEccccEEEEccccEEEEEcccccEEEEEEEEccccccccccEEEEEEEEEccccccEEEEEEEEEcccEEEEEEEcccccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHHccccHHHHccccccccccccccHHHccccccccccccccccccccccccccccHHccccccccccccEEEEEEcccccccHHHHHHHHHHHHcccccccHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccccccccccccccHHHHccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHcccccccccccEEEEEEcccccccccccccEEEEEEEEcccEEEEEEEEcccccEEEEEEEcccccEEEEEEccc //