[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56778.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:84 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   24->57 PF05644 * DUF800 0.00029 23.5 34/246  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56778.1 GT:GENE ACF56778.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 586804..587058 GB:FROM 586804 GB:TO 587058 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56778.1 GB:DB_XREF GI:194358330 LENGTH 84 SQ:AASEQ MDKQYLHEKLDAMRQNFVESTHHERAVGVLDQAHMSKKMLKIKKKLVALEMERCQRKIEHKDCSKIDQKIKEQKEIFESCCKKD GT:EXON 1|1-84:0| SEG 37->46|kkmlkikkkl| SEG 65->76|kidqkikeqkei| HM:PFM:NREP 1 HM:PFM:REP 24->57|PF05644|0.00029|23.5|34/246|DUF800| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,84-85| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //