[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56787.1
DDBJ      :             conserved domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:65 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56787.1 GT:GENE ACF56787.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 566212..566409 GB:FROM 566212 GB:TO 566409 GB:DIRECTION + GB:PRODUCT conserved domain protein GB:PROTEIN_ID ACF56787.1 GB:DB_XREF GI:194358339 LENGTH 65 SQ:AASEQ MLATLESEARKKVGYLQVKTVAEGSNKDYDRTNDFYRGLGFKKXEIFSQLWNPQNPCQIXIKKLE GT:EXON 1|1-65:0| OP:NHOMO 18 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11---------11-------------------11-111-1-1--------------1------------------------------1----11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,65-66| PSIPRED cHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHHHcccEEEEHHHHHcccccccEEEEEEcc //