[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56791.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:262 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->259 3c5wP PDBj 3e-11 12.9 %
:RPS:SCOP  19->259 1mt3A  c.69.1.7 * 2e-11 18.7 %
:HMM:SCOP  20->260 1xklA_ c.69.1.20 * 5.2e-12 20.5 %
:HMM:PFM   53->255 PF00561 * Abhydrolase_1 3.7e-06 16.7 186/231  
:BLT:SWISS 18->194 ESL2_MYCGE 1e-05 27.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56791.1 GT:GENE ACF56791.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 687770..688558 GB:FROM 687770 GB:TO 688558 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF00561 GB:PROTEIN_ID ACF56791.1 GB:DB_XREF GI:194358343 LENGTH 262 SQ:AASEQ MKRFEVSTEIGSLSVAYQKQKKVLVCLNGAGLLPSYENFSLILEKPPPTIGYLTIDFPNTGRSPIYDQAGKNLDNLADVVYEALEELGISEYILCVHSWSGILACKLLEKPIKCQTLVAIEPTTKKVMFADFSENPYPEMEEQMRLIDECGPELYFKNLTQATFSPETNKKIWELMQEKGLELENQDPEFQISGEITEEDFENLSIESHVPIFIFCQTYREKEYRESEYWTSNTKLILGGNHHYLQWSESEKIAAIIRELSE GT:EXON 1|1-262:0| BL:SWS:NREP 1 BL:SWS:REP 18->194|ESL2_MYCGE|1e-05|27.7|173/268| RP:PDB:NREP 1 RP:PDB:REP 1->259|3c5wP|3e-11|12.9|256/294| HM:PFM:NREP 1 HM:PFM:REP 53->255|PF00561|3.7e-06|16.7|186/231|Abhydrolase_1| RP:SCP:NREP 1 RP:SCP:REP 19->259|1mt3A|2e-11|18.7|241/293|c.69.1.7| HM:SCP:REP 20->260|1xklA_|5.2e-12|20.5|239/0|c.69.1.20|1/1|alpha/beta-Hydrolases| OP:NHOMO 17 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1-----------------------1112211111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 262 STR:RPRED 100.0 SQ:SECSTR EEccEEEcccEEEccEEEEcccEEEEEccTTccccGGGGHHHHHHHHTTEEcEEEccTTcTTcccccccHHHHHHHHHHHHHHHTccccccEEEEEEHHHHHHHHHTTccTTEEEEEEEcccHHHHHHHHHHHHHHHTTcccEEccHHHHHHHHHHHTccccHHHHHHHHGGGTEEEcccEEEcccGGGGGGGHHHHHTTHHHHHHHccccEEEEEccGGccHHHHHHHHTTccEEEcTTccccHHHHcHHHHHHHHHHHHc DISOP:02AL 1-1| PSIPRED ccEEEEEcccEEEEEEEcccccEEEEEccccccccHHHHHHHHHHccccccEEEEcccccccccccccccccHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHcHHHHHEEEEEccccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccHHHHHHccccccccEEEEcccccHHHHHHHHHccccEEEEEcccccEEEcccHHHHHHHHHHHHc //