[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56792.1
DDBJ      :             ABC transporter substrate binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  541/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:284 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->283 1p99A PDBj 4e-43 39.4 %
:RPS:PDB   33->284 1dtzA PDBj 2e-18 7.2 %
:RPS:SCOP  40->283 1p99A  c.94.1.1 * 1e-69 38.7 %
:HMM:SCOP  35->284 1p99A_ c.94.1.1 * 2.7e-70 49.2 %
:RPS:PFM   55->278 PF03180 * Lipoprotein_9 2e-50 55.2 %
:HMM:PFM   36->284 PF03180 * Lipoprotein_9 6.3e-93 48.5 237/237  
:BLT:SWISS 23->278 METQ_YERPE 1e-37 38.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56792.1 GT:GENE ACF56792.1 GT:PRODUCT ABC transporter substrate binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 152518..153372 GB:FROM 152518 GB:TO 153372 GB:DIRECTION + GB:PRODUCT ABC transporter substrate binding protein GB:NOTE identified by match to protein family HMM PF03180 GB:PROTEIN_ID ACF56792.1 GB:DB_XREF GI:194358344 LENGTH 284 SQ:AASEQ MKIKKWLGLXALATVAGLALAACGNSEKKADNATTIKIATVNRSGSEEKRWDKIQELVKKDGITLEFTEFTDYSQPNKATADGEVNLNAFQHYNFLNNWNKENGKDLVAIGDTYISPIRLYSGLNGSANKYTKVEDIPANGEIAVPNDATNESRALYLLQSAGLIKLDVSGTALATVANIKENPKNLKITELDASQTARSLSSVDAAVVNNTFVTEAKLDYKKALFKEQADENSKQWYNIIVAKKDWETSPKADAIKKVIAAYHTDDVKKVIEETSDGLDQPVW GT:EXON 1|1-284:0| BL:SWS:NREP 1 BL:SWS:REP 23->278|METQ_YERPE|1e-37|38.5|239/271| TM:NTM 1 TM:REGION 6->27| SEG 7->22|lglxalatvaglalaa| BL:PDB:NREP 1 BL:PDB:REP 40->283|1p99A|4e-43|39.4|236/255| RP:PDB:NREP 1 RP:PDB:REP 33->284|1dtzA|2e-18|7.2|249/689| RP:PFM:NREP 1 RP:PFM:REP 55->278|PF03180|2e-50|55.2|212/236|Lipoprotein_9| HM:PFM:NREP 1 HM:PFM:REP 36->284|PF03180|6.3e-93|48.5|237/237|Lipoprotein_9| RP:SCP:NREP 1 RP:SCP:REP 40->283|1p99A|1e-69|38.7|235/257|c.94.1.1| HM:SCP:REP 35->284|1p99A_|2.7e-70|49.2|238/255|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 1062 OP:NHOMOORG 544 OP:PATTERN -------------------------------------------------------------------- -----2211111111----------2------1121112-----121211111-1111-----111121111222111-122-------------------1---------------11111111----------------------------------------------------------1-2------12444444442444444313312344112244322222223322222222222222322223212232311132334412123244433341111111111111111111111111111111112221111-2112333333313--2221---111211----11-1-11-1-11-1-11---111-111-11-125---322-222222222213---2--2-2-1--21121111111132-----11411---11111111-11---13-----------------------------------343435455552444244434444235484244--222--2228-113--------111111111--------------1-------------------1----2211444441121111111-1-----221-1-----1--------------------------------43431422222222222-2222222222222222221676441142222222222222222422211121-322222222222--1-111111111---1-22211111111211144444321111-33333543234341333111111111-1111111111211111111111111111---4---------------11---------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------4-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 255 STR:RPRED 89.8 SQ:SECSTR #############################ccccccEEEEEcccHHHHHHHHHHHHHHHTTTcccEEEEEcccHHHHHHHHHTTccccEEEcHHHHHHHHcTTTcEEEEEEEccccccccccEEEEEEEEEccccccGGTTcEEEEccTTcTTTTHHHHTGGGTccccTTccHHHHHHHHccEEEcTTccTTTcHHHHTTccccGGGTTcccTTcTcTTcHHHHHHHHHHcccccEEEEETTHHHHHcccHHHHTTEEEEETTTEEEcGGGTTTcccEEEEccEE DISOP:02AL 1-1,23-36| PSIPRED cccHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHcccccEEccccHHHHHHHHHHccccEEEEEEEEEEcccccccccccccccccHHHcccccEEEEccccccHHHHHHHHHHcccEEEcccccccccHHHHHHcccccEEEEccHHHHHHHHccccEEEEccHHHHHccccHHHEEEEccccccccccEEEEEEcHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHcccccccc //