[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56796.1
DDBJ      :             ribosomal large subunit pseudouridine synthase D
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  903/915 : Eukaryota  186/199 : Viruses  0/175   --->[See Alignment]
d.265.1d.66.1
:295 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   9->294 2istA PDBj 3e-51 42.7 %
:RPS:PDB   9->290 3dh3B PDBj 9e-41 22.3 %
:RPS:SCOP  9->95 1dm9A  d.66.1.3 * 2e-15 23.0 %
:RPS:SCOP  76->295 1v9kA  d.265.1.3 * 2e-63 37.6 %
:HMM:SCOP  11->109 1c06A_ d.66.1.2 * 3.1e-18 37.8 %
:HMM:SCOP  65->294 1przA_ d.265.1.3 * 1.4e-76 48.2 %
:RPS:PFM   11->54 PF01479 * S4 7e-04 52.3 %
:RPS:PFM   85->235 PF00849 * PseudoU_synth_2 8e-29 50.3 %
:HMM:PFM   82->235 PF00849 * PseudoU_synth_2 3.8e-39 38.4 151/164  
:HMM:PFM   11->55 PF01479 * S4 6.9e-13 51.1 45/48  
:BLT:SWISS 11->295 YLYB_BACSU 2e-99 61.8 %
:PROS 128->142|PS01129|PSI_RLU

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56796.1 GT:GENE ACF56796.1 GT:PRODUCT ribosomal large subunit pseudouridine synthase D GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 830629..831516 GB:FROM 830629 GB:TO 831516 GB:DIRECTION + GB:PRODUCT ribosomal large subunit pseudouridine synthase D GB:NOTE identified by match to protein family HMM PF00849; match to protein family HMM PF01479; match to protein family HMM TIGR00005 GB:PROTEIN_ID ACF56796.1 GB:DB_XREF GI:194358348 LENGTH 295 SQ:AASEQ MEIKIETGGLRLDKALSDLSELSRSLANEQIKSGQVLVNGQVKKAKYTVQEGDVVTYHVPEPEVLEYVAEDLPLEIVYQDEDVAVVNKPQGMVVHPSAGHTSGTLVNALMYHIKDLSGINGVLRPGIVHRIDKDTSGLLMIAKNDDAHLALAQELKDKKSLRKYWAIVHGNLPNDRGVIEAPIGRSEKDRKKQAVTAKGKPAVTRFHVLERFGDYSLVELQLETGRTHQIRVHMAYIGHPVAGDEVYGPRKTLKGHGQFLHAKTLGFTHPRTGKTLEFKADIPEIFKETLERLRK GT:EXON 1|1-295:0| BL:SWS:NREP 1 BL:SWS:REP 11->295|YLYB_BACSU|2e-99|61.8|285/303| PROS 128->142|PS01129|PSI_RLU|PDOC00869| BL:PDB:NREP 1 BL:PDB:REP 9->294|2istA|3e-51|42.7|279/321| RP:PDB:NREP 1 RP:PDB:REP 9->290|3dh3B|9e-41|22.3|238/241| RP:PFM:NREP 2 RP:PFM:REP 11->54|PF01479|7e-04|52.3|44/46|S4| RP:PFM:REP 85->235|PF00849|8e-29|50.3|143/149|PseudoU_synth_2| HM:PFM:NREP 2 HM:PFM:REP 82->235|PF00849|3.8e-39|38.4|151/164|PseudoU_synth_2| HM:PFM:REP 11->55|PF01479|6.9e-13|51.1|45/48|S4| GO:PFM:NREP 5 GO:PFM GO:0003723|"GO:RNA binding"|PF01479|IPR002942| GO:PFM GO:0001522|"GO:pseudouridine synthesis"|PF00849|IPR006145| GO:PFM GO:0003723|"GO:RNA binding"|PF00849|IPR006145| GO:PFM GO:0009451|"GO:RNA modification"|PF00849|IPR006145| GO:PFM GO:0009982|"GO:pseudouridine synthase activity"|PF00849|IPR006145| RP:SCP:NREP 2 RP:SCP:REP 9->95|1dm9A|2e-15|23.0|87/104|d.66.1.3| RP:SCP:REP 76->295|1v9kA|2e-63|37.6|213/227|d.265.1.3| HM:SCP:REP 11->109|1c06A_|3.1e-18|37.8|98/159|d.66.1.2|1/1|Alpha-L RNA-binding motif| HM:SCP:REP 65->294|1przA_|1.4e-76|48.2|226/252|d.265.1.3|1/1|Pseudouridine synthase| OP:NHOMO 3150 OP:NHOMOORG 1094 OP:PATTERN --------------------------------------11111------------------------- 2121132233321222223-42112222222222223233111111321111212211111113312222212221112111111222444414-311122223234424-2222222-211114111111111112222211131223233311223323313212222113111113111133311221433-3333333333333322443333333333323333334533333333333333333333-34344343334444444443333333333333333333333333333333333334333334333333332333333333333343333333334332342133141121212223133214333322222333333333333322222222223-323333332232233222222222334433333333333333333333333334222222222331122222222222222122233333222222223222222222222222222222222232224352454444234332224434444442222548142437323422123343443347677972433323333333333333333433332266654464774688888A977789-A989A2-3233322122244444554444444444-44444444444444444445554444544444444444444445444444431544444444444222422222222233635555455454554445555455434446344344444-33434442222222226777566666667665544444333222222444433332223222252211112-22122222122222222222222222222242 ----342-211122311111111111111111--1-1111111111111111111111111122222211332223322322222211-2221222111112131111G36343323-212131331224C3-32322114234213112332333133-12343314224-1122446KA78134466174A872127 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 294 STR:RPRED 99.7 SQ:SECSTR #HHHHHHHcEEHHHHHHTTTcccHHHHHHHHHTTcEEETTEEccTTcEEcccccEEETTEEEcccTTccccccccccGGGccEEEEEEcTTcccccccccTTcHHHHHTcccccEEHHHTTccccEEccccccccEEEEEEEccTHHHHHHHcGGGcccHHEEEEEEEcccccHHHHHHHHcccHHHHHHHHTcccccccccccEEccEEEEccccEEEEEEccccTTHHHHHHHHTTccEEEEEEEEETEEEEETTEEcTTccTTcEEEccHHHHHHHHHTccccccccTTccE PSIPRED ccccHHHccccHHHHHHHcccccHHHHHHHHHcccEEEccEEEccccEEccccEEEEEEccccccccccccccccccccccEEEEEEccccEEEEcccccccccHHHHHHHHHHHHccccccccEEEEEcccccccEEEEEEccHHHHHHHHHHHHHccEEEEEEEEEEcccccccEEEEcccEEcccccEEEEEEccccccccEEEEEEEEccEEEEEEEEcccccHHHHHHHHHccccEEcccccccHHHccccccEEEEEEEEEcccccccEEEEEccccHHHHHHHHHHHc //