[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56801.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  57/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.159.1
:280 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   116->212 2a22B PDBj 8e-04 30.2 %
:RPS:PDB   6->223 3e0jA PDBj 2e-10 12.1 %
:RPS:SCOP  3->248 1nnwA  d.159.1.5 * 1e-21 17.9 %
:HMM:SCOP  1->251 1nnwA_ d.159.1.5 * 7e-54 36.7 %
:HMM:PFM   3->165 PF00149 * Metallophos 2.4e-07 20.2 163/200  
:BLT:SWISS 4->236 Y912_METJA 9e-08 31.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56801.1 GT:GENE ACF56801.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1488083..1488925) GB:FROM 1488083 GB:TO 1488925 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF00149 GB:PROTEIN_ID ACF56801.1 GB:DB_XREF GI:194358353 LENGTH 280 SQ:AASEQ MTKIALLSDIHGNTTALEAVLADARQLGVDEYWLLGDILMPGTGRRRILDLLDQLPITARVLGNWEDSLWHGVRKELDSTRPSQRYLLRQCQYVLEEISLEEIEVLHNQPLQIHRQFGDLTVGISHHLPDKNWGRELIHTGKQEEFDRLVTHPPCDIAVYGHIHQQLLRYGTGGQLIVNPGSIGQPFFLDAQLRKDLRAQYMILEFDDKGLVDMDFRRVDYDVAAELQLAKDLRLPYFEVYYESLVNGIHHTHHQEFLRELAQKEGCDRELDDWLKSGND GT:EXON 1|1-280:0| BL:SWS:NREP 1 BL:SWS:REP 4->236|Y912_METJA|9e-08|31.2|208/243| SEG 94->106|vleeisleeievl| BL:PDB:NREP 1 BL:PDB:REP 116->212|2a22B|8e-04|30.2|86/203| RP:PDB:NREP 1 RP:PDB:REP 6->223|3e0jA|2e-10|12.1|207/416| HM:PFM:NREP 1 HM:PFM:REP 3->165|PF00149|2.4e-07|20.2|163/200|Metallophos| RP:SCP:NREP 1 RP:SCP:REP 3->248|1nnwA|1e-21|17.9|234/251|d.159.1.5| HM:SCP:REP 1->251|1nnwA_|7e-54|36.7|237/251|d.159.1.5|1/1|Metallo-dependent phosphatases| OP:NHOMO 79 OP:NHOMOORG 60 OP:PATTERN -----------------------------------------------1------1-1----------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------1111111211112111-----111------1-----1--------------------------11-1---221122-1---1----------2--22232123212-------------1-----------1-1------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------1----1-----11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 243 STR:RPRED 86.8 SQ:SECSTR cccEEHHHHHHTcHHccccHHHHHHHTTEEEEEEEcccccccHHHHHHHHHHHHHHTTccEEEEccTTcccccccccccccTTccHHHHTcTTEEEccccEEEEETTEEEEEcccHHHHHHHHcccccHHHHHHHHHHcTcccccccTTcccccccEEEEEEEcccEEEEEEEcccccEEEEEEEEcHHHcGGTcHHHcEEEEEETTTTcccEEEccccccccccccccHHHHc#EEEEEEccc#################################### DISOP:02AL 279-281| PSIPRED cEEEEEEccccccHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHccccEEEEcccccHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHHHHHccccEEEEEEccEEEEEEEccccccccccccccccHHHHHHHHHHccccEEEEccccHHHHHcccccEEEEEccccccccccccccccccccEEEEEEEEcccEEEEEEEEccccHHHHHHHHHHcccccHHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHccc //