[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56802.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:69 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->68 PF02677 * DUF208 3e-14 56.5 %
:HMM:PFM   1->68 PF02677 * DUF208 1.4e-21 46.8 62/176  
:BLT:SWISS 1->67 Y882_HAEIN 1e-07 41.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56802.1 GT:GENE ACF56802.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1737767..1737976) GB:FROM 1737767 GB:TO 1737976 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56802.1 GB:DB_XREF GI:194358354 LENGTH 69 SQ:AASEQ MHVCCAPCSTYTLEYLTKYADVTIYFANSNIHPKAEYHKRVYVTKKFVSDFNERTGNTVQYLEAPYEPN GT:EXON 1|1-69:0| BL:SWS:NREP 1 BL:SWS:REP 1->67|Y882_HAEIN|1e-07|41.0|61/100| RP:PFM:NREP 1 RP:PFM:REP 1->68|PF02677|3e-14|56.5|62/176|DUF208| HM:PFM:NREP 1 HM:PFM:REP 1->68|PF02677|1.4e-21|46.8|62/176|DUF208| OP:NHOMO 55 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111-------------------1----11111111111------1-1----1111111111111-11---111----11----------------------1-1-------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 68-70| PSIPRED cEEEEcccHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHccccccEEccccccc //