[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56805.1
DDBJ      :             ATP-dependent DNA helicase
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  620/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:605 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->578 2is1B PDBj 2e-25 23.3 %
:RPS:PDB   22->348,451->571 3e1sA PDBj 5e-21 12.4 %
:RPS:SCOP  28->578 1qhh.1  c.37.1.19 * 1e-27 22.4 %
:HMM:SCOP  5->578 1qhh.1 c.37.1.19 * 2.8e-63 22.8 %
:RPS:PFM   30->350 PF00580 * UvrD-helicase 2e-24 29.9 %
:RPS:PFM   494->571 PF01443 * Viral_helicase1 1e-04 34.4 %
:HMM:PFM   27->107 PF00580 * UvrD-helicase 1.3e-14 31.2 80/533  
:HMM:PFM   182->432 PF00580 * UvrD-helicase 3.8e-32 23.3 245/533  
:HMM:PFM   492->572 PF01443 * Viral_helicase1 4.9e-07 22.7 66/226  
:BLT:SWISS 31->576 UVRD_MYCCT 1e-31 30.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56805.1 GT:GENE ACF56805.1 GT:PRODUCT ATP-dependent DNA helicase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1215305..1217122) GB:FROM 1215305 GB:TO 1217122 GB:DIRECTION - GB:PRODUCT ATP-dependent DNA helicase GB:NOTE identified by match to protein family HMM PF00580 GB:PROTEIN_ID ACF56805.1 GB:DB_XREF GI:194358357 LENGTH 605 SQ:AASEQ MVKSEEWFPKGDIILEETALGAVKDVTNCLVIAGPGAGKTELLAQKLDYLFSTNKCVSPKKILALSFKTDAASNLKERVKKRYGDEYASRFTSLTYSAFEKRILDQFRDVLPEDIRPSRDYLIEDWYTIKELLSMNGINVNGWRMSDIRRYVENIILNNGDNHKFKTDLLKGTQDNKPVLLYRQITKLSTQIIDTNEYIRKALQMTYDFVFLDEFQDTTYAQYDLLKTCFLGSSCKLTAVGDDKQAIMRWAGAKPDIFPDYIRDFNPNEYQLLMNHRSVPKLVEFQKEVHQILNSNHSSIQTNNYPEFQEGEITLFEFENESLEAKLIANDIESKIQGGIRPSEICILAKQKVGIYSFELISILNSKGIKARIENEYQDILKDPTCNLLLDLISCSQGKRDPLIWENISNFYGNINGIDELTDELILAKSYKEIDNIVSDITYLISNFIPNEESMLKLIDCIIEKIDEKRIISNFSTYNGKSDLDIIVKNFSKLLYIEYSQTQGEWLDTVSSFKGENSIPIMTIHKSKGLEYEVVYFLGLEDSAFWSFNNQPEEDKSAFFVALSRAKSHLIFTYCKLRNNSPQNNRNINEIYSLLTQSNLVDVIN GT:EXON 1|1-605:0| BL:SWS:NREP 1 BL:SWS:REP 31->576|UVRD_MYCCT|1e-31|30.9|514/722| SEG 579->589|nnspqnnrnin| BL:PDB:NREP 1 BL:PDB:REP 27->578|2is1B|2e-25|23.3|527/624| RP:PDB:NREP 1 RP:PDB:REP 22->348,451->571|3e1sA|5e-21|12.4|429/517| RP:PFM:NREP 2 RP:PFM:REP 30->350|PF00580|2e-24|29.9|311/449|UvrD-helicase| RP:PFM:REP 494->571|PF01443|1e-04|34.4|64/220|Viral_helicase1| HM:PFM:NREP 3 HM:PFM:REP 27->107|PF00580|1.3e-14|31.2|80/533|UvrD-helicase| HM:PFM:REP 182->432|PF00580|3.8e-32|23.3|245/533|UvrD-helicase| HM:PFM:REP 492->572|PF01443|4.9e-07|22.7|66/226|Viral_helicase1| GO:PFM:NREP 5 GO:PFM GO:0003677|"GO:DNA binding"|PF00580|IPR000212| GO:PFM GO:0004003|"GO:ATP-dependent DNA helicase activity"|PF00580|IPR000212| GO:PFM GO:0005524|"GO:ATP binding"|PF00580|IPR000212| GO:PFM GO:0006281|"GO:DNA repair"|PF00580|IPR000212| GO:PFM GO:0004386|"GO:helicase activity"|PF01443|IPR000606| RP:SCP:NREP 1 RP:SCP:REP 28->578|1qhh.1|1e-27|22.4|541/623|c.37.1.19| HM:SCP:REP 5->578|1qhh.1|2.8e-63|22.8|545/0|c.37.1.19|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 868 OP:NHOMOORG 635 OP:PATTERN --------------------------------1---------1---11--1-1--------------- -1--11--111-211--11-1----1111111----1111--2---1--11-------11----21----------------111111------111--1--1-12122-----------------1-11111111---------1--1--------------------------11-----------11-22-22222111211112112221-112111--1-1----1-1121111111111211-111-111111111--1111111111112111111---11111122112111111111111111112211121222213333333331212122122222121122-111---1141---11111-11111111111-----------------------------1----1-------1------1-1--1-1-1--2-1---------------1-----111---11111-11111111---1-1---22222222222222222222222222222211211111--1122-4211112122222111-1111--111211-2-----3--------11---1-1--2--1321221111122122221221112111221213122212-21-112111-2122-111---2111--11132211221111111121-111111111111111111111212113111111111111111111111111-1211111111111--221111111112221322222122222222221112111121111111211-2211-22222222222222223222223311211111111111---1112332244222121111-2111-1-11111--111111221111-11--11111--1 --------------------------1-------------------------1-----------1-----------------------------1----------1---1-------------------------------------------------------------------------------112------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 557 STR:RPRED 92.1 SQ:SECSTR #####################HHHHHHHHHHHHHHHTccccEEHHHHHHHHHEHHHcccHHHHHHHHHHHHHHTccEEEcccccccccccccEEEcHHHHHHHHHHHHHHHHHHHccccccccccccccTTTTTTccHHHHHHHHHHTTccEEEEEccTTccHHHHHHHHHHTTccEEEEEcHHHHHHHHHHTccEEEHHHHTTEEccEEEEccGGGccHHHHHHHHTTccTTTcEEEEEEcTTccccccccHccEEEcccccHHHHTcHHHHHHHHHHTTcccccccTTEEEEEcccTTcHTTTcccTTHHHHHHHHHHTTcGGGcEEEEcccccTTcHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHTTHHTTccccccHHHHHHHHHHHTTccHHHHHHHHTTTcccccTHHHTcccHHHHHHHHHHHHHHHHHHHTTccccccccEEccccEEcTTcEEEEccccTTTTccTTcEEEEEEEccccEEEEETTEEEEEcGGGGTTEEEccEEEHHHHTTccEEEEEEEEcGGGGGGccHHHcGGGHHHHHHHHHTEEEEEEEEEccEE########################### DISOP:02AL 1-3,577-588| PSIPRED cccHHHHcccccccccHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHHcccccHHHEEEEEEcccHHHHHHHHHHHHcccccccccEEEEEHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHccccEEEEccHHHccHHHHHHHHHHHcccccEEEEEEcccccccHHccccHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHccccHHcccccccccccccEEEEEEccHHHHHHHHHHHHHHHHHccccHHHEEEEEccHHHHHHHHHHHHHHHcccEEEEccHHHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHcEEEEEEcccccccccccccHHHccHHHHHHHHHHHcc //