[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56806.1
DDBJ      :             PTS system, IIB component
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  161/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.44.2
:105 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->97 1e2bA PDBj 4e-09 38.7 %
:RPS:PDB   1->97 1e2bA PDBj 2e-04 38.7 %
:RPS:SCOP  6->97 1iibA  c.44.2.1 * 3e-04 38.6 %
:HMM:SCOP  3->105 1iibA_ c.44.2.1 * 4.1e-31 57.6 %
:RPS:PFM   6->97 PF02302 * PTS_IIB 4e-04 41.5 %
:HMM:PFM   6->98 PF02302 * PTS_IIB 3.1e-26 46.5 86/90  
:BLT:SWISS 4->100 PTEB_BACST 1e-17 46.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56806.1 GT:GENE ACF56806.1 GT:PRODUCT PTS system, IIB component GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1633623..1633940) GB:FROM 1633623 GB:TO 1633940 GB:DIRECTION - GB:PRODUCT PTS system, IIB component GB:NOTE identified by match to protein family HMM PF02302 GB:PROTEIN_ID ACF56806.1 GB:DB_XREF GI:194358358 LENGTH 105 SQ:AASEQ MAKVTIMLACAAGMSTSLLVTKMQKAAEDKGLDAEIFAVPAPEAEEIVATKEVNVLLLGPQVRYLLGDFQEKLKDRQIPVAVIPMTDYGMMNGSKVLDLAESLLD GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 4->100|PTEB_BACST|1e-17|46.3|95/100| SEG 34->49|aeifavpapeaeeiva| BL:PDB:NREP 1 BL:PDB:REP 1->97|1e2bA|4e-09|38.7|93/106| RP:PDB:NREP 1 RP:PDB:REP 1->97|1e2bA|2e-04|38.7|93/106| RP:PFM:NREP 1 RP:PFM:REP 6->97|PF02302|4e-04|41.5|82/86|PTS_IIB| HM:PFM:NREP 1 HM:PFM:REP 6->98|PF02302|3.1e-26|46.5|86/90|PTS_IIB| GO:PFM:NREP 2 GO:PFM GO:0008982|"GO:protein-N(PI)-phosphohistidine-sugar phosphotransferase activity"|PF02302|IPR003501| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF02302|IPR003501| RP:SCP:NREP 1 RP:SCP:REP 6->97|1iibA|3e-04|38.6|88/103|c.44.2.1| HM:SCP:REP 3->105|1iibA_|4.1e-31|57.6|99/103|c.44.2.1|1/1|PTS system, Lactose/Cellobiose specific IIB subunit| OP:NHOMO 337 OP:NHOMOORG 162 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------2333322331322323224432333-1211-35666661--------------------141--34--1-133--431-12-311111113332--222333332332222222222222322---2221-1-181111111111-5---112-------1--------------1---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------14----------------------------------------1311-21---1-1-111----11--111-1------135433111----------------3---------2------------------------------------------1----------------------------------------11131111111--1-----------------1-------11---------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 90.5 SQ:SECSTR cccEEEEEEccccTTTHHHHHHHHHHHHHccccEEEEEEccccTTHHHHHHHccEEEEcTTcGGGHHHHHHHcccc##ccccccHHHHTTTcTTHHH######## DISOP:02AL 1-1| PSIPRED ccccEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEEHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHHHHHccEEEEEcHHHHccccHHHHHHHHHHHHc //