[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56809.1
DDBJ      :             ABC transporter, substrate binding protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  453/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:182 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->180 1xt8B PDBj 4e-55 56.2 %
:RPS:PDB   1->161 3c31A PDBj 6e-20 21.1 %
:RPS:SCOP  1->180 1xt8A1  c.94.1.1 * 1e-26 55.6 %
:HMM:SCOP  1->161 2a5sA1 c.94.1.1 * 9.1e-34 36.2 %
:RPS:PFM   3->161 PF00497 * SBP_bac_3 2e-16 35.7 %
:HMM:PFM   3->162 PF00497 * SBP_bac_3 5e-36 33.8 160/225  
:BLT:SWISS 6->161 GLNH_BACSU 9e-20 30.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56809.1 GT:GENE ACF56809.1 GT:PRODUCT ABC transporter, substrate binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(629457..630005) GB:FROM 629457 GB:TO 630005 GB:DIRECTION - GB:PRODUCT ABC transporter, substrate binding protein GB:NOTE contains potential frameshift GB:PROTEIN_ID ACF56809.1 GB:DB_XREF GI:194358361 LENGTH 182 SQ:AASEQ MISNKVDITLANFTVTDERKKQVDFALPYMKVSLGVVSPKTGLITDVKQLEGKTLIVTKGTTAETYFEKNHPEIKLQKYDQYSDSYQALLDGRGDAFSTDNTEVLAWALENKGFEVGITSLGDPDTIAAAVQKGNQELLDFINKDIEKLGKENFFHKAYEKTLHPTYGDAAKADDLVVEGGH GT:EXON 1|1-182:0| BL:SWS:NREP 1 BL:SWS:REP 6->161|GLNH_BACSU|9e-20|30.3|155/273| BL:PDB:NREP 1 BL:PDB:REP 3->180|1xt8B|4e-55|56.2|178/251| RP:PDB:NREP 1 RP:PDB:REP 1->161|3c31A|6e-20|21.1|161/254| RP:PFM:NREP 1 RP:PFM:REP 3->161|PF00497|2e-16|35.7|157/222|SBP_bac_3| HM:PFM:NREP 1 HM:PFM:REP 3->162|PF00497|5e-36|33.8|160/225|SBP_bac_3| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| RP:SCP:NREP 1 RP:SCP:REP 1->180|1xt8A1|1e-26|55.6|180/248|c.94.1.1| HM:SCP:REP 1->161|2a5sA1|9.1e-34|36.2|160/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 1060 OP:NHOMOORG 460 OP:PATTERN -----1-----------------1----------------------11---------1---------- -----1--112---11111-12--1211111122222224-1111--1----1121-1------3222-1133333331-2----------------------------1------------------------------------1-----------------1-1112--------------11-11---111222223312222221---3222221-121-1----1511---------------1---23132162333113311132-321112221---2223334444333411111111111112126552223--2-311-1111----122----11-1-2-11-44-3-11--1111--12--------2--2--1----------44414154457---1--1-1----43332233235542-----21--1---------------1---------------------------------------3221233342-122222-4212123123111---22---11-111433-------212211--1-------11-2325224555-1-11-2----------2-22-4222222111111111-22----441-------2-----------------------1--------43543353333332333-3333333333333333335555452225445555555555555533333331-545555554555--2------1111--1-21112-2---------22222--112--44443764323212545----------111311111211--------------------------------------------------------------121-111111--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 181 STR:RPRED 99.5 SQ:SECSTR HHTTcccEEcccccccHHHHTTEEEccccEEEcEEEEEEcccccccHHHHHTccccEcTTcHHHHHHHHcccHHHHHHHHHHHHHHHTTccccHHHHHHHHHHccEEEEEEHHHHHHHHTTcTTEEEEccEEETTcTHHHHHHHHHHHHHHTTHHHHHHHHccEEEEcccHHHHTHTcEcc# DISOP:02AL 182-183| PSIPRED cccccEEEEEccccccHHHHHHHHHcccEEEccEEEEEEcccccccHHHHcccEEEEEcccHHHHHHHHHccccEEEEEccHHHHHHHHHcccccEEEEcHHHHHHHHHHccccEEEEcccccccEEEEEEEcccHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccccccEEEEccc //