[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56815.1
DDBJ      :             transcriptional regulator, GntR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  89/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.67.1d.81.1
:180 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->69 3by6E PDBj 6e-05 23.5 %
:RPS:PDB   7->80 2b7oB PDBj 2e-14 9.6 %
:RPS:PDB   97->156 2d3jA PDBj 5e-06 10.2 %
:RPS:SCOP  4->71 1e2xA1  a.4.5.6 * 3e-14 26.5 %
:RPS:SCOP  115->154 1gr0A2  d.81.1.3 * 3e-06 17.5 %
:HMM:SCOP  3->76 1hw1A1 a.4.5.6 * 5e-14 29.7 %
:HMM:SCOP  63->156 1wstA1 c.67.1.1 * 9.3e-05 24.7 %
:RPS:PFM   8->69 PF00392 * GntR 1e-05 32.3 %
:HMM:PFM   6->69 PF00392 * GntR 6.1e-15 31.2 64/64  
:BLT:SWISS 6->166 YCXD_BACSU 6e-18 32.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56815.1 GT:GENE ACF56815.1 GT:PRODUCT transcriptional regulator, GntR family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1301030..1301572 GB:FROM 1301030 GB:TO 1301572 GB:DIRECTION + GB:PRODUCT transcriptional regulator, GntR family GB:NOTE contains potential frameshift; identified by match to protein family HMM PF00392 GB:PROTEIN_ID ACF56815.1 GB:DB_XREF GI:194358367 LENGTH 180 SQ:AASEQ MKKQSKYKEVVSYLKNGIESERFPTGSRLPSIRQLSLDFHCSKDTIQRALLELRHEQYLYAKPQSGYYVLEQGQHQDLEIEVTDEHASAYDDFRLCVNETLIGRENYLFNYYDNQEGLEDLRQSIHKLLFEQALYCKANQLVLTSGTQQALFILSQISFPRQAKEILGGTANLPSDEIAS GT:EXON 1|1-180:0| BL:SWS:NREP 1 BL:SWS:REP 6->166|YCXD_BACSU|6e-18|32.5|160/444| BL:PDB:NREP 1 BL:PDB:REP 2->69|3by6E|6e-05|23.5|68/124| RP:PDB:NREP 2 RP:PDB:REP 7->80|2b7oB|2e-14|9.6|73/438| RP:PDB:REP 97->156|2d3jA|5e-06|10.2|59/157| RP:PFM:NREP 1 RP:PFM:REP 8->69|PF00392|1e-05|32.3|62/64|GntR| HM:PFM:NREP 1 HM:PFM:REP 6->69|PF00392|6.1e-15|31.2|64/64|GntR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00392|IPR000524| GO:PFM GO:0005622|"GO:intracellular"|PF00392|IPR000524| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00392|IPR000524| RP:SCP:NREP 2 RP:SCP:REP 4->71|1e2xA1|3e-14|26.5|68/73|a.4.5.6| RP:SCP:REP 115->154|1gr0A2|3e-06|17.5|40/85|d.81.1.3| HM:SCP:REP 3->76|1hw1A1|5e-14|29.7|74/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 63->156|1wstA1|9.3e-05|24.7|93/0|c.67.1.1|1/1|PLP-dependent transferases| OP:NHOMO 116 OP:NHOMOORG 90 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------122223222-333223-211112221--1---------21------------------12--------------------------11111111111111111111111111111111111111111111----11111111-1-1-------2-------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 159 STR:RPRED 88.3 SQ:SECSTR cccHHHcHHHHHHHHHHHHHHHTTcccEEEEEEccccccTccHHHHHHHHHHHHHHHHHHHHHTcEEEEEEcccccccccHHHHHHHHHHHHccHHcccEEcTTccEEEEEEEccTTTccEEEEEEEEEEccccccccEEccccEEEEccccEEEEHHH##################### DISOP:02AL 1-3| PSIPRED cccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEcccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccHHHEEEEHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHc //