[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56818.1
DDBJ      :             adenylate cyclase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  118/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.63.1
:189 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->182 2gfgC PDBj 4e-23 36.1 %
:RPS:PDB   2->189 3bhdA PDBj 4e-22 15.9 %
:RPS:SCOP  4->171 2acaA1  d.63.1.2 * 6e-18 14.9 %
:HMM:SCOP  1->189 2acaA1 d.63.1.2 * 1.2e-26 28.0 %
:RPS:PFM   4->155 PF01928 * CYTH 1e-08 39.3 %
:HMM:PFM   3->188 PF01928 * CYTH 1.8e-37 29.9 177/187  
:BLT:SWISS 2->189 YJBK_BACSU 6e-26 36.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56818.1 GT:GENE ACF56818.1 GT:PRODUCT adenylate cyclase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(976378..976947) GB:FROM 976378 GB:TO 976947 GB:DIRECTION - GB:PRODUCT adenylate cyclase GB:NOTE identified by match to protein family HMM PF01928 GB:PROTEIN_ID ACF56818.1 GB:DB_XREF GI:194358370 LENGTH 189 SQ:AASEQ MKHLEIELKTLLKKDEYNRLKDQFTGVTPVLQTNYYIDTLDFELREKKVAMRIRTFEDWAELTLKVPQSVGNMEYNQKLQLKDAENYLSKEELPQGLVLDELAKHGIQSKNWQVLGCLTTLRYEMKTAIGLMALDQSRYFDMTDYELELEVENHEQGKQDFRQFLEKNQISYQKAPSKLVRFVKSMKNS GT:EXON 1|1-189:0| BL:SWS:NREP 1 BL:SWS:REP 2->189|YJBK_BACSU|6e-26|36.4|184/100| BL:PDB:NREP 1 BL:PDB:REP 2->182|2gfgC|4e-23|36.1|180/185| RP:PDB:NREP 1 RP:PDB:REP 2->189|3bhdA|4e-22|15.9|176/208| RP:PFM:NREP 1 RP:PFM:REP 4->155|PF01928|1e-08|39.3|135/184|CYTH| HM:PFM:NREP 1 HM:PFM:REP 3->188|PF01928|1.8e-37|29.9|177/187|CYTH| GO:PFM:NREP 2 GO:PFM GO:0004016|"GO:adenylate cyclase activity"|PF01928|IPR008172| GO:PFM GO:0006171|"GO:cAMP biosynthetic process"|PF01928|IPR008172| RP:SCP:NREP 1 RP:SCP:REP 4->171|2acaA1|6e-18|14.9|148/174|d.63.1.2| HM:SCP:REP 1->189|2acaA1|1.2e-26|28.0|164/0|d.63.1.2|1/1|CYTH-like phosphatases| OP:NHOMO 118 OP:NHOMOORG 118 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111--1111111111111111111111-1111-111----11------11111111111111111111111111111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 99.5 SQ:SECSTR #ccEEEEEEEcccTTHHHHHHHTcEEEEEEEEEEEEEEcTTcHHHHTTcEEEEETTTEETEEEEEcccTTccTTcEEEEEccHHHHHHHHHHHHTcccccHHHHHHHHTcEEEEEEEEEEEEEEEEGGGGcccEEEETTTEEEccEEEEEEEEETTcHHHHHHHHHHTccTTcccccHHHHHHHHHcHH DISOP:02AL 1-1,187-190| PSIPRED ccHHHHHHHHcccHHHHHHHHHHHccccccEEEEEEEEcccHHHHHccccEEEEEEccEEEEEEEcccccccEEEEEEcccccHHHHHccccccccHHHHHHHHHcccHHHEEEEEEccEEEEEEEccccEEEEEcccccccccEEEEEEcccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHc //