[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56826.1
DDBJ      :             response regulator TCS03
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  772/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:210 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->204 1rnlA PDBj 1e-32 37.4 %
:RPS:PDB   1->205 3c3wA PDBj 5e-34 37.6 %
:RPS:SCOP  1->117 1a0oA  c.23.1.1 * 9e-21 25.9 %
:RPS:SCOP  143->204 1a04A1  a.4.6.2 * 8e-18 45.2 %
:HMM:SCOP  1->131 1k66A_ c.23.1.1 * 5.9e-31 29.0 %
:HMM:SCOP  123->209 1p4wA_ a.4.6.2 * 7.7e-24 36.8 %
:RPS:PFM   3->114 PF00072 * Response_reg 3e-12 37.3 %
:RPS:PFM   145->199 PF00196 * GerE 2e-12 60.0 %
:HMM:PFM   3->114 PF00072 * Response_reg 1.4e-27 36.0 111/112  
:HMM:PFM   144->199 PF00196 * GerE 2.5e-24 51.8 56/58  
:BLT:SWISS 1->205 LIAR_BACSU 8e-57 51.2 %
:PROS 159->186|PS00622|HTH_LUXR_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56826.1 GT:GENE ACF56826.1 GT:PRODUCT response regulator TCS03 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 346850..347482 GB:FROM 346850 GB:TO 347482 GB:DIRECTION + GB:PRODUCT response regulator TCS03 GB:NOTE identified by match to protein family HMM PF00072; match to protein family HMM PF00196; match to protein family HMM PF08281 GB:PROTEIN_ID ACF56826.1 GB:DB_XREF GI:194358378 LENGTH 210 SQ:AASEQ MKILLVDDHEMVRLGLKSYFDLQDDVEVVGEASNGSQGIDLALELRPDVIVMDIVMPEMNGIDATLAILKEWPEAKILIVTSYLDNEKIMPVLDAGAKGYMLKTSSADELLHAVSKVAAGELAIEQEVSKKVEYHRNHMELHEELTARERDVLQLIAKGYENQRIADDLFISLKTVKTHVSNILAKLEVSDRTQAAVYAFQHHLVGHEEF GT:EXON 1|1-210:0| BL:SWS:NREP 1 BL:SWS:REP 1->205|LIAR_BACSU|8e-57|51.2|205/211| PROS 159->186|PS00622|HTH_LUXR_1|PDOC00542| BL:PDB:NREP 1 BL:PDB:REP 3->204|1rnlA|1e-32|37.4|195/200| RP:PDB:NREP 1 RP:PDB:REP 1->205|3c3wA|5e-34|37.6|205/211| RP:PFM:NREP 2 RP:PFM:REP 3->114|PF00072|3e-12|37.3|110/111|Response_reg| RP:PFM:REP 145->199|PF00196|2e-12|60.0|55/57|GerE| HM:PFM:NREP 2 HM:PFM:REP 3->114|PF00072|1.4e-27|36.0|111/112|Response_reg| HM:PFM:REP 144->199|PF00196|2.5e-24|51.8|56/58|GerE| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 2 RP:SCP:REP 1->117|1a0oA|9e-21|25.9|116/128|c.23.1.1| RP:SCP:REP 143->204|1a04A1|8e-18|45.2|62/67|a.4.6.2| HM:SCP:REP 1->131|1k66A_|5.9e-31|29.0|131/149|c.23.1.1|1/1|CheY-like| HM:SCP:REP 123->209|1p4wA_|7.7e-24|36.8|87/0|a.4.6.2|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 5683 OP:NHOMOORG 808 OP:PATTERN -----------------------82112-123--22--2222243-2812414-2-2122-------1 BHH3n85644442475533-38116G333334HBCBELLL7G9ZJQB77EC98CA849119AN8aEQambD5333D66-3329-112-3344-211---6-A469R4Q58---------------1---1--11--GLMMK87BQ9F7AC9764522221442884EHIH2122111131111576323228CGBBCBCBED9EBBBBFDIGGCHCFEBEFIA55865668X*755555535555555555442-1-23-11-2332333221-1-11123344455335554555555544444444454445443333342AK7BL7776967264F5773353I6A32G5562EBCD988968647E123G313333-----37I694244355633233322233-98699DBA5B8-7554966798785232252464453542222222211112C43------------------------------2352-65436878BC788885AAINBBBD4EBEFGGNH13CCAAD687ABDGE46958A7A831111111-15A9B5DB453B52A96672EEKE78F79557576823113111111--1-------5B222--A92957988526989A4A7AAAA776BA9B--14635------A4456858AA7976799-A999878898A79778776788687759889999999899999788777883-A88888788888--4544444111215B3511111211111-223222222344346FGHFDJHJECDEA9GCF-----1---27A8778888AE7BEGDECFCB99C32321172663333--------4---------------------------21323222223Q1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------2-1---------4--3-----3---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 208 STR:RPRED 99.0 SQ:SECSTR EEEEEEcccHHHHHHHHHHHHTcTTEEEEEEEccHHHHHHHHHHHcccEEEEccEETTEEHHHHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHGGGccHHHHHHHHHHHHHccTTTTccHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHHHHHHTTcccccHHHHHHHHHTTTHHH## DISOP:02AL 129-146,208-211| PSIPRED cEEEEEccHHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHcccccccHHHHHHHHHccccccccccccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccHHHc //