[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56828.1
DDBJ      :             methyltransferase, HemK family protein
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  843/915 : Eukaryota  75/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:279 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->275 1sg9A PDBj 2e-21 39.2 %
:RPS:PDB   1->273 2b3tA PDBj 5e-32 26.7 %
:RPS:SCOP  38->273 1t43A  c.66.1.30 * 4e-61 32.5 %
:HMM:SCOP  1->253 1nv8A_ c.66.1.30 * 4.6e-55 34.3 %
:RPS:PFM   114->249 PF05175 * MTS 6e-23 52.0 %
:HMM:PFM   104->240 PF05175 * MTS 7.8e-25 36.5 115/170  
:HMM:PFM   14->91 PF07638 * Sigma70_ECF 0.00054 18.4 76/185  
:BLT:SWISS 19->272 HEMK_BACSU 1e-35 39.1 %
:PROS 179->185|PS00092|N6_MTASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56828.1 GT:GENE ACF56828.1 GT:PRODUCT methyltransferase, HemK family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 910617..911456 GB:FROM 910617 GB:TO 911456 GB:DIRECTION + GB:PRODUCT methyltransferase, HemK family protein GB:NOTE identified by match to protein family HMM PF05175; match to protein family HMM PF08241; match to protein family HMM PF08242; match to protein family HMM TIGR00536 GB:PROTEIN_ID ACF56828.1 GB:DB_XREF GI:194358380 LENGTH 279 SQ:AASEQ MKLAQLFSNFEEELIRQGEEAESLSFVYRSLKNLSFTDFIFALQQEVTTEEEKQFVEDIYQQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILTENLETNLSVLDIGTGSGAIALALAKNRPDWSVTAADVSQEALELASENASDQNFNIFFKKSDCFAEISEKYDIIVSNPPYISREDESEVGLNVLHSEPHLALFADEDGLAIYCRIAEDAKDYLKDGGKIYLEIGYKQGQSVPELFRKHLPEKRVRTLKDQFGQDRMVVVDDGQD GT:EXON 1|1-279:0| BL:SWS:NREP 1 BL:SWS:REP 19->272|HEMK_BACSU|1e-35|39.1|248/288| PROS 179->185|PS00092|N6_MTASE|PDOC00087| SEG 95->112|eteelveliltenletnl| BL:PDB:NREP 1 BL:PDB:REP 40->275|1sg9A|2e-21|39.2|222/274| RP:PDB:NREP 1 RP:PDB:REP 1->273|2b3tA|5e-32|26.7|270/276| RP:PFM:NREP 1 RP:PFM:REP 114->249|PF05175|6e-23|52.0|125/154|MTS| HM:PFM:NREP 2 HM:PFM:REP 104->240|PF05175|7.8e-25|36.5|115/170|MTS| HM:PFM:REP 14->91|PF07638|0.00054|18.4|76/185|Sigma70_ECF| GO:PFM:NREP 1 GO:PFM GO:0008168|"GO:methyltransferase activity"|PF05175|IPR007848| RP:SCP:NREP 1 RP:SCP:REP 38->273|1t43A|4e-61|32.5|234/275|c.66.1.30| HM:SCP:REP 1->253|1nv8A_|4.6e-55|34.3|245/271|c.66.1.30|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1271 OP:NHOMOORG 933 OP:PATTERN --------------------------------1--12-1111------------11111111------ 11111111111---11111-111111111111111122221-1-11111---1--1-1111-111111111----1111--1111111111111111--21111111111111111111111111111111111111111111111111111111111-1---1111111111111111111111111111121111111111111111121111111122121111111112211111111111111211221121221112211112211111122211111111111111111111111111111111111112221111111111111111111111111111121111111111111111111111111111111111111-2222222212111111111111---1--1-122-11111112111221-1111111111111--------------1111111---11-1111111111111111111-1-11211122222221222222222222222222222221122222222222222222222222212222222221111111111111-111111111111111111111111-11-111111111111111112222222222222222222222222222222-2222311111122222222222222222-2222222222222222222222223322222112111222222222222222222222222222222221111122222222222222222322222222222222222222222223222222222222222222222222222222222222222222222221121--111111-111111-1----1-111-111111111-111-11111-11221121 ----------1-111--11--------------------------------------------1--111--111-----1-111--1-------11-------221-1-1111111-1--1-1-11121341-111111-1-11--1---1--1-2112---11---1-1---211-1-----1-11----11-1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 279 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHHHHHTTTTcccHHHHHHHHHHHHHTccHHHHHHTTTccccHHHHHHHHHHEHHHHHTTccHHHHccEEEETTEEEEccTTcccccTTHHHHHHHHHHHccccccEEEEETcTTcHHHHHHHHHcTTcEEEEEcccHHHHHHHHHHHHHHTccEEEcccTTGGGTTccEEEEEEccccccTTcHHHHEccGGGccccTTTccHHHHTHHHHHHHHHHGGGEEEEEEEEEEcccccHHHHHHHHHHTcTcTTccEEEcTTccEEEEEEEHHHE DISOP:02AL 279-280| PSIPRED ccHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHcccccccHHHHHHHHHHHHHHHccccHHHHccccccccEEEEEccccccccccHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccEEEEEccccccccccEEEEEEcccccccccHHHccHHHHcccHHHHHHccccHHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHcccccEEEEEccccccEEEEEEcccc //