[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56832.1
DDBJ      :             hypothetical protein
Swiss-Prot:Y154_STRZP   RecName: Full=UPF0176 protein SPP_0154;

Homologs  Archaea  0/68 : Bacteria  519/915 : Eukaryota  76/199 : Viruses  0/175   --->[See Alignment]
c.46.1d.58.4
:328 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   22->92 3br8A PDBj 8e-09 14.1 %
:RPS:PDB   110->281 1e0cA PDBj 9e-23 12.9 %
:RPS:SCOP  7->89 1mwqA  d.58.4.7 * 3e-09 23.5 %
:RPS:SCOP  119->253 1yt8A3  c.46.1.2 * 5e-21 17.5 %
:HMM:SCOP  88->253 1qb0A_ c.46.1.1 * 2.4e-34 32.3 %
:RPS:PFM   291->318 PF12368 * DUF3650 4e-07 75.0 %
:HMM:PFM   291->318 PF12368 * DUF3650 3.5e-17 67.9 28/28  
:HMM:PFM   121->215 PF00581 * Rhodanese 2.6e-14 33.7 95/113  
:BLT:SWISS 1->328 Y154_STRZP 0.0 99.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56832.1 GT:GENE ACF56832.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 94141..95127 GB:FROM 94141 GB:TO 95127 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF56832.1 GB:DB_XREF GI:194358384 LENGTH 328 SQ:AASEQ MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGMEELWFKIDEESEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTRNDYEYDLGHFRGAIRPDIRNFREXPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKDPEVQGELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEENEDKYLRGCSHECRVHPRNRYVSKNELTQAEVIERLAAIGESLDQAATV GT:EXON 1|1-328:0| SW:ID Y154_STRZP SW:DE RecName: Full=UPF0176 protein SPP_0154; SW:GN OrderedLocusNames=SPP_0154; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->328|Y154_STRZP|0.0|99.7|328/328| RP:PDB:NREP 2 RP:PDB:REP 22->92|3br8A|8e-09|14.1|71/90| RP:PDB:REP 110->281|1e0cA|9e-23|12.9|170/270| RP:PFM:NREP 1 RP:PFM:REP 291->318|PF12368|4e-07|75.0|28/28|DUF3650| HM:PFM:NREP 2 HM:PFM:REP 291->318|PF12368|3.5e-17|67.9|28/28|DUF3650| HM:PFM:REP 121->215|PF00581|2.6e-14|33.7|95/113|Rhodanese| RP:SCP:NREP 2 RP:SCP:REP 7->89|1mwqA|3e-09|23.5|81/100|d.58.4.7| RP:SCP:REP 119->253|1yt8A3|5e-21|17.5|126/157|c.46.1.2| HM:SCP:REP 88->253|1qb0A_|2.4e-34|32.3|158/178|c.46.1.1|1/1|Rhodanese/Cell cycle control phosphatase| OP:NHOMO 700 OP:NHOMOORG 595 OP:PATTERN -------------------------------------------------------------------- -----111111111-----------------------111--------1---111111--------------------------------------1--1-1121111-1111111111111111-------------------1-111-111--1111111111--111-1111111111111-1-----1-11111111111111111-1111111---211111111112-11111111111111111111----------------------1111111---1--1111111111111111111111111111111111----------------------------------------------------1111-11111--111111-----11111111111----------1--111111111111--111111----11111111111---1----1111111111111111111111111111111111-11111111111111111111111111111111111111112--12211-22-1111---------------1-------------------------------------------------------------11111111-111111-111111111111------1111111111-111111111111-11111111111111111111111111-111111111111111111-1111111111111111111--11111111111-1111---------------1111111111-111111111111111111111111111-1--111111111--11111111111111----111111----------11111---------------------------------- --------------1--------------------------------1-------------------------------------------------------332--2-2111-1111111113112-4E1-32311111-1111111-1-1111111111-2-----------1122B333114335-426775554 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 295 STR:RPRED 89.9 SQ:SECSTR ########cccTTcccTTccccHHHHHHHHHHTTccTTcEEEEEcccTTccccHHHHHHHHHHTTcccEEEEETHHHHHHHTTccccccccccccccccccccGGGEEccGGGTTcccEEcHHHHHTTTTcTTEEEEEcccHHHHHHcccTTcEEccGGGGHHHHHHHHHHTccTTcEEEEEcccccHHHHHHHHHHHHTTcccEEEETTHHHHHHHcGTTcccccccccccccccccccccTTcccHHHHHHHTTcTTEEEEEcccHHHHTTccccccccccEEEccccHHHHHHHHHHHHH######################### DISOP:02AL 1-2,300-329| PSIPRED ccccEEEEEEEEEEEcccHHHHHHHHHHHHHHccccEEEEEccccEEEEEEccHHHHHHHHHHHHHcccccccEEEEcccccccccHHEEEEcccccccccccccccccccccccccccccHHHHHHHHHcccEEEEEcccHHHHHHccccccccccHHHHHHHHHHHHHHcccccccEEEEEEcccHHHHHHHHHHHHcccccEEEEccHHHHHHHHcccccccccccEEEEccEEEccHHHccccEEEcccccccHHHHEEccccHHHHccccccHHHHHHccccccHHHHHHHHccccccccccHHHHHHHHHHHHcccHHHccc //