[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56836.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  193/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.68.7
:328 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   154->325 3gkuB PDBj 4e-12 26.1 %
:RPS:PDB   259->325 2cpmA PDBj 3e-10 19.7 %
:RPS:SCOP  269->325 1mszA  d.68.7.1 * 3e-09 16.1 %
:HMM:SCOP  268->329 1mszA_ d.68.7.1 * 1.5e-08 32.8 %
:RPS:PFM   273->325 PF01424 * R3H 2e-05 51.9 %
:HMM:PFM   273->325 PF01424 * R3H 4.3e-18 40.4 52/55  
:HMM:PFM   116->181 PF10065 * DUF2303 7.1e-05 25.8 66/276  
:HMM:PFM   215->243 PF07650 * KH_2 0.00034 27.6 29/59  
:HMM:PFM   32->115 PF03233 * Cauli_AT 0.00073 24.1 83/163  
:BLT:SWISS 142->325 JAG_BACSU 1e-13 28.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56836.1 GT:GENE ACF56836.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1855499..1856485) GB:FROM 1855499 GB:TO 1856485 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF56836.1 GB:DB_XREF GI:194358388 LENGTH 328 SQ:AASEQ MVVFTGSTVEEAIQKGLKELDIPRMKAHIKVISREKKGFLGLFGKKPAQVDIEAISETTVVKANQQVVKGVPKKINDLNEPVKTVSEETVDLGHVVDAIKKIEEEGQGISDEVKAEILKHERHASTILEETGHIEILNELQIEEAMREEAGADDLETEQDQAESQELEDLGLKVETNFDIEQVATEVMAYVQTIIDDMDVEATLSNDYNRRSINLQIDTNEPGRIIGYHGKVLKALQLLAQNYLYNCYSRTFYITINVNDYVEHRAXVLQTYAQKLAIRVLEEGRSHQTDPMSNSERKIIHRIISRMDGVTSYSEGDEPNRYVVVDTE GT:EXON 1|1-328:0| BL:SWS:NREP 1 BL:SWS:REP 142->325|JAG_BACSU|1e-13|28.6|182/208| SEG 36->46|kkgflglfgkk| BL:PDB:NREP 1 BL:PDB:REP 154->325|3gkuB|4e-12|26.1|165/187| RP:PDB:NREP 1 RP:PDB:REP 259->325|2cpmA|3e-10|19.7|66/94| RP:PFM:NREP 1 RP:PFM:REP 273->325|PF01424|2e-05|51.9|52/56|R3H| HM:PFM:NREP 4 HM:PFM:REP 273->325|PF01424|4.3e-18|40.4|52/55|R3H| HM:PFM:REP 116->181|PF10065|7.1e-05|25.8|66/276|DUF2303| HM:PFM:REP 215->243|PF07650|0.00034|27.6|29/59|KH_2| HM:PFM:REP 32->115|PF03233|0.00073|24.1|83/163|Cauli_AT| GO:PFM:NREP 1 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF01424|IPR001374| RP:SCP:NREP 1 RP:SCP:REP 269->325|1mszA|3e-09|16.1|56/62|d.68.7.1| HM:SCP:REP 268->329|1mszA_|1.5e-08|32.8|61/0|d.68.7.1|1/1|R3H domain| OP:NHOMO 195 OP:NHOMOORG 193 OP:PATTERN -------------------------------------------------------------------- ---1--------------------11-----11----111---1---11---111-----1-1--1----111111111--1------------------------------------------------------111--1111--------------------------------------11-------11111111111111111-1--1111111111--111111111-------------------1-1-11-1---11111111----11111111111111111111111111111111131111111111111-11111111111111-111111111--11111111111-1111111--11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1----1111---------------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--------------------------11--11111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 174 STR:RPRED 53.0 SQ:SECSTR #########################################################################################################################################################HTTccGGGEEEEcccccEEEEEEcccHHHHHHHHHHHHHHHHHHTccccEEEETTTTEEEEEccGGGGGGGGTTTHHHHHHHHHHHHHHHHHHTcccccEEEEEEccccccHHHHHHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHTTcEEEEEcccccccEEEEE# DISOP:02AL 120-130,141-161,328-329| PSIPRED cEEEEcccHHHHHHHHHHHHcccHHEEEEEEEEEccccEEcccccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccccHHHHEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccEEEEEEccccccEEEccccEEHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHHccccEEEEEcccccEEEEEEcc //