[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56841.1
DDBJ      :             thioredoxin family protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  395/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->161 2f9sA PDBj 8e-18 38.5 %
:RPS:PDB   49->182 3c73B PDBj 1e-24 31.2 %
:RPS:SCOP  49->184 2fy6A1  c.47.1.10 * 1e-26 28.7 %
:HMM:SCOP  43->184 2b5xA1 c.47.1.10 * 4.6e-36 39.7 %
:RPS:PFM   45->164 PF08534 * Redoxin 2e-19 40.9 %
:HMM:PFM   45->179 PF08534 * Redoxin 5.9e-32 36.7 128/146  
:BLT:SWISS 51->166 Y1453_HAEIN 1e-22 37.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56841.1 GT:GENE ACF56841.1 GT:PRODUCT thioredoxin family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 888844..889401 GB:FROM 888844 GB:TO 889401 GB:DIRECTION + GB:PRODUCT thioredoxin family protein GB:NOTE identified by match to protein family HMM PF00578; match to protein family HMM PF08534 GB:PROTEIN_ID ACF56841.1 GB:DB_XREF GI:194358393 LENGTH 185 SQ:AASEQ MKKVMFAGLSLLSLVVLMACGQEETKKTQAAQQPKQQTTVQQISVGKDAPDFTLQSMDGKEVKLSDFKGKKVYLKFWASWCGPCKKSMPELMELAAKPDRDFEILTVIAPGIQGEKTVEQFPQWFQEQGYKDIPVLYDTKATTFQAYQIRSIPTEYLIDSQGKIGKIQFGAISNADAEAAFKEMN GT:EXON 1|1-185:0| BL:SWS:NREP 1 BL:SWS:REP 51->166|Y1453_HAEIN|1e-22|37.1|116/156| TM:NTM 1 TM:REGION 4->21| SEG 25->42|tkktqaaqqpkqqttvqq| BL:PDB:NREP 1 BL:PDB:REP 46->161|2f9sA|8e-18|38.5|109/133| RP:PDB:NREP 1 RP:PDB:REP 49->182|3c73B|1e-24|31.2|128/138| RP:PFM:NREP 1 RP:PFM:REP 45->164|PF08534|2e-19|40.9|115/132|Redoxin| HM:PFM:NREP 1 HM:PFM:REP 45->179|PF08534|5.9e-32|36.7|128/146|Redoxin| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF08534|IPR013740| RP:SCP:NREP 1 RP:SCP:REP 49->184|2fy6A1|1e-26|28.7|136/143|c.47.1.10| HM:SCP:REP 43->184|2b5xA1|4.6e-36|39.7|141/0|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 671 OP:NHOMOORG 403 OP:PATTERN -------------------------------------------------------1--1-1------- 237-1-------------------------------------12------------------1----1--1--------21211-1113328-311----17121L3249---------------32-11111-313333311122-------------------------------------2121211-2333333334323343332533333342422323------331------------------------------------------------21114112222222222211111111111112---------111-2111111111111---111311--3--1-11-1--11-11111-41213---1111-1111112111-11111111111111---1--1-1-1--------1-----111-11111111111--------1-1-1-12------------1111111111111----1112--2221321111211111112-111111222-111-111311-21-1----1112121--2222222121--11--------------122321111222235-11--------------------1---------244-21133222-2122223211253---11-3-----------------------------------------------------------------------------111111-11111---1---------112-1---12--11111--1---------1-311211-11111111------------2---------------111211111------1---11-----------1-------------------------------------2- -------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------2-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 77.3 SQ:SECSTR ##########################################ccTTccccccEEEcTTccEEEGGGGTTcEEEEEEEcTTcTTHHHHHHHHHHHHHHGGGTEEEEEEEEccEEcccccHHHHHHHHHHTTccccEEEETTcHHHHHHTcccccEEEEEcTTccEEEEEEccccHHHHHHHHHHHH DISOP:02AL 27-44| PSIPRED ccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHccccccccEEEcccccEEEHHHHcccEEEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEEEccccccccHHHHHHHHHHHccccEEEEEcccHHHHHHcccccccEEEEEccccEEEEEEEccccHHHHHHHHHHcc //