[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56849.1
DDBJ      :             peptidase T
Swiss-Prot:PEPT_STRZJ   RecName: Full=Peptidase T;         EC=3.4.11.4;AltName: Full=Tripeptide aminopeptidase;AltName: Full=Aminotripeptidase;         Short=Tripeptidase;

Homologs  Archaea  0/68 : Bacteria  328/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.56.5d.58.19
:283 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->282 1vixB PDBj 2e-70 50.4 %
:RPS:PDB   3->282 3dljB PDBj 7e-20 15.7 %
:RPS:SCOP  5->276 1fnoA4  c.56.5.4 * 7e-81 40.0 %
:HMM:SCOP  3->212 1fnoA4 c.56.5.4 * 6.2e-45 31.7 %
:HMM:SCOP  211->282 1fnoA3 d.58.19.1 * 3.3e-27 61.1 %
:HMM:PFM   209->282 PF07687 * M20_dimer 1.1e-10 21.7 69/109  
:HMM:PFM   142->206 PF05343 * Peptidase_M42 6.9e-08 23.8 63/292  
:BLT:SWISS 1->282 PEPT_STRZJ e-164 98.9 %
:PROS 76->85|PS00758|ARGE_DAPE_CPG2_1
:PROS 140->179|PS00759|ARGE_DAPE_CPG2_2

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56849.1 GT:GENE ACF56849.1 GT:PRODUCT peptidase T GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(900842..901693) GB:FROM 900842 GB:TO 901693 GB:DIRECTION - GB:PRODUCT peptidase T GB:NOTE contains potential frameshift; identified by match to protein family HMM PF07687; match to protein family HMM TIGR01882 GB:PROTEIN_ID ACF56849.1 GB:DB_XREF GI:194358401 LENGTH 283 SQ:AASEQ MTYPNLLDRFLTYVKVNTRSDEHSTTTPSTQSQVDFATNVLIPEMKRVGLQNVYYLPNGFAIGTLPANDPSLTRKIGFISHMDTADFNAEGVNPQVIENYDGGVIELGNSGFKLDPADFKSLEKYPGQTLITTDGTSLLGADDKSGIAEIMTAIEYLTAHPEIKHCEIRVGFGPDEEIGVGANKFDAEDFDVDFAYTVDGGPLXELQYETFSAAGAELHFQGRNVHPGTAKGQMVNALQLAIDFHNQLPXNDRPELTEGYQGFYHLMDVTGSVEEVRASYIIX GT:EXON 1|1-283:0| SW:ID PEPT_STRZJ SW:DE RecName: Full=Peptidase T; EC=3.4.11.4;AltName: Full=Tripeptide aminopeptidase;AltName: Full=Aminotripeptidase; Short=Tripeptidase; SW:GN Name=pepT; OrderedLocusNames=SPJ_0948; SW:KW Aminopeptidase; Complete proteome; Cytoplasm; Hydrolase;Metal-binding; Metalloprotease; Protease; Zinc. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->282|PEPT_STRZJ|e-164|98.9|282/407| GO:SWS:NREP 6 GO:SWS GO:0004177|"GO:aminopeptidase activity"|Aminopeptidase| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0008237|"GO:metallopeptidase activity"|Metalloprotease| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| PROS 76->85|PS00758|ARGE_DAPE_CPG2_1|PDOC00613| PROS 140->179|PS00759|ARGE_DAPE_CPG2_2|PDOC00613| BL:PDB:NREP 1 BL:PDB:REP 1->282|1vixB|2e-70|50.4|280/410| RP:PDB:NREP 1 RP:PDB:REP 3->282|3dljB|7e-20|15.7|254/467| HM:PFM:NREP 2 HM:PFM:REP 209->282|PF07687|1.1e-10|21.7|69/109|M20_dimer| HM:PFM:REP 142->206|PF05343|6.9e-08|23.8|63/292|Peptidase_M42| RP:SCP:NREP 1 RP:SCP:REP 5->276|1fnoA4|7e-81|40.0|270/295|c.56.5.4| HM:SCP:REP 3->212|1fnoA4|6.2e-45|31.7|208/0|c.56.5.4|1/1|Zn-dependent exopeptidases| HM:SCP:REP 211->282|1fnoA3|3.3e-27|61.1|72/113|d.58.19.1|1/1|Bacterial exopeptidase dimerisation domain| OP:NHOMO 372 OP:NHOMOORG 333 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------2---------1111-111---1111111-1-1--------------------------------------------------------------------------------1--1111111111111111111111111111111111111111111111111111111111112212-12122211111111111111111111111111111111111111111111111111111111111--1111111111111-2--11111--21111--11----1---111-111--2-----------11111111111----------1---1---------1--111111121-------------11------------------------------------------------------------------------------------------------------------1-------------1--------------------------------11------11----------------11----------------1----1-11-11--2----------12222211111111111-111121111111111111111122112111111111111111121111111--122222211222---------------------111-11111--1---------------------------------------23311111111111-----------------2--------------1-1-------------------------------------1 --------211--------------------------------------------------------------------------------------------------1-----------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 282 STR:RPRED 99.6 SQ:SECSTR ccHHHHHHHHHHHHTccccccccHHccHHHHHHHHHHHHHHHHHHHHTTcEcEEEEcccEEEccEEEcccEEEEEEcccTTccEEEEEEEcccccccGGGTcEEEcTTEEEEccEcccTTccEEETTcTTcccEEEcTTTTTTHHHHHHHHHHHHHHHHTTcccccEEEEEEEccGGGTcTTHHHHHHHTTTTTTTTcccccEEEEEEcEEEEEEEEEEcccccEETTTTTTccccHHHHHHHHHTTcccTTccccccccTTTTTTcccccHHHHHHHHTcc# DISOP:02AL 1-1,20-29| PSIPRED ccHHHHHHHHHHHEEccccccccccEEEccHHHHHHHHHHHHHHHHHccccEEEEccccEEEEEEcccccccccEEEEEEEcccccccccccccEEEcccccccccccccccEEcHHHcccHHHcccccEEEEcccEEEEcccHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccHHHccHHHccccEEEEEccccccEEEEEcccEEEEEEEEEEccccccccccccccHHHHHHHHHHHccccccccccccccEEEEEEEccccEEEEEEEEEEc //