[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56850.1
DDBJ      :             Prophage maintenance system killer protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:137 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   18->125 3dd9E PDBj 4e-16 20.8 %
:HMM:PFM   4->88 PF02661 * Fic 7.8e-14 25.9 85/96  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56850.1 GT:GENE ACF56850.1 GT:PRODUCT Prophage maintenance system killer protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 788149..788562 GB:FROM 788149 GB:TO 788562 GB:DIRECTION + GB:PRODUCT Prophage maintenance system killer protein GB:NOTE identified by match to protein family HMM PF05012; match to protein family HMM TIGR01550 GB:PROTEIN_ID ACF56850.1 GB:DB_XREF GI:194358402 LENGTH 137 SQ:AASEQ MTIYLTEKQIEKINALAIQRYSPNEKIQTVSSSALNMIVNLPEQFVFGKSLYPTIFDKATILFVQLIKKHVFANANKRTAFFVLVKFLQLNGYRFSVTVEEAVKMCVTIAVEALTDEKMTSYSKWVSEHSVREKVKK GT:EXON 1|1-137:0| RP:PDB:NREP 1 RP:PDB:REP 18->125|3dd9E|4e-16|20.8|106/110| HM:PFM:NREP 1 HM:PFM:REP 4->88|PF02661|7.8e-14|25.9|85/96|Fic| OP:NHOMO 25 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------111----2-----------------------------------------------1----------------1---------1------------------------------1--11------11--------------------------1--11111111-------------1-------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 93.4 SQ:SECSTR ##ccccHHHHHHHHHHHcccccHHHHHHHHccccccHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHTTcccccccTTHHHHHHHHHTTcccHHHHHHHHHHHHHHT####### DISOP:02AL 132-138| PSIPRED cEEEEcHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHHcc //