[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56854.1
DDBJ      :             PTS system,  IIA component
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  263/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.112.1
:145 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->140 1a3aD PDBj 4e-26 40.6 %
:RPS:PDB   1->142 1a3aA PDBj 2e-30 39.7 %
:RPS:SCOP  1->142 1a3aA  d.112.1.1 * 1e-30 39.7 %
:HMM:SCOP  1->145 1a3aA_ d.112.1.1 * 1.2e-32 38.3 %
:RPS:PFM   3->144 PF00359 * PTS_EIIA_2 9e-20 40.6 %
:HMM:PFM   3->142 PF00359 * PTS_EIIA_2 7.7e-34 38.2 136/142  
:BLT:SWISS 1->144 PTMA_STRMU 2e-57 72.9 %
:PROS 46->62|PS00372|PTS_EIIA_TYPE_2_HIS

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56854.1 GT:GENE ACF56854.1 GT:PRODUCT PTS system, IIA component GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 355871..356308 GB:FROM 355871 GB:TO 356308 GB:DIRECTION + GB:PRODUCT PTS system, IIA component GB:NOTE identified by match to protein family HMM PF00359 GB:PROTEIN_ID ACF56854.1 GB:DB_XREF GI:194358406 LENGTH 145 SQ:AASEQ MKLEKHLIKLNKQFSNKEEAICYCGQVLYEGGYVNEDYIEAMIERDKELSVYMGNFIAIPHGTDAAKNDVLKSGITVVQVPRGVDFGNVSNPQVATVLFGIAGIGNEHLEIIQKISIFCADVDNVLKLADAQSKEEVLRLFDAVE GT:EXON 1|1-145:0| BL:SWS:NREP 1 BL:SWS:REP 1->144|PTMA_STRMU|2e-57|72.9|144/145| PROS 46->62|PS00372|PTS_EIIA_TYPE_2_HIS|PDOC00528| BL:PDB:NREP 1 BL:PDB:REP 2->140|1a3aD|4e-26|40.6|138/144| RP:PDB:NREP 1 RP:PDB:REP 1->142|1a3aA|2e-30|39.7|141/145| RP:PFM:NREP 1 RP:PFM:REP 3->144|PF00359|9e-20|40.6|138/142|PTS_EIIA_2| HM:PFM:NREP 1 HM:PFM:REP 3->142|PF00359|7.7e-34|38.2|136/142|PTS_EIIA_2| GO:PFM:NREP 3 GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF00359|IPR002178| GO:PFM GO:0006810|"GO:transport"|PF00359|IPR002178| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF00359|IPR002178| RP:SCP:NREP 1 RP:SCP:REP 1->142|1a3aA|1e-30|39.7|141/145|d.112.1.1| HM:SCP:REP 1->145|1a3aA_|1.2e-32|38.3|141/145|d.112.1.1|1/1|Phoshotransferase/anion transport protein| OP:NHOMO 402 OP:NHOMOORG 263 OP:PATTERN -------------------------------------------------------------------- ----1----------------1----------1----------1--1--2111-1-----1-11------------------------------------------------------------------------111-----2--------------------------------------11------111---------------132111----11-11111121111-111111111111111--112---23-----11--21-11---111--------1121111221111----------------------2-1-15111111111--3--1222-----11-------------222-1-1--------1111---------------------------------------------------------1--------------1---1-------------------------------------------------------------------------111--1---------------1----------------1--------------------------------------------------------222-------2---------------------1----11-11122121222222222222-22122222222222212225352212-3223222222233332222122221-322222222222--1-------------1-222212-1111-11211111-1-------1--111--1---111----------222222222241221------------------------------------------111--1111-1------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 100.0 SQ:SECSTR ccccGGGEEcccccccHHHHHHHHHHHHHHTTcccTHHHHHHHHHHHHcccEEETTEEcccccGGGGGGccccEEEEEEEEEEEEccccTTccEEEEEEEEEccTTTHHHHHHHHHHHTccHHHHHHHHHcccHHHHHHHTTTcc DISOP:02AL 1-1| PSIPRED ccccHHHEEEccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccccccHHHcccHHcEEEEEEEcccEEccccccccEEEEEEEEccccHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHccc //