[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56867.1
DDBJ      :             acetyltransferase, GNAT family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  304/915 : Eukaryota  61/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:231 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->213 2z0zA PDBj 2e-17 36.4 %
:RPS:PDB   84->198 3dnsA PDBj 2e-21 15.6 %
:RPS:SCOP  41->198 2fckA1  d.108.1.1 * 3e-31 19.4 %
:HMM:SCOP  22->199 2fckA1 d.108.1.1 * 5e-41 35.3 %
:HMM:PFM   96->173 PF00583 * Acetyltransf_1 3.7e-09 27.3 77/83  
:BLT:SWISS 3->228 YIW2_YEAST 2e-60 49.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56867.1 GT:GENE ACF56867.1 GT:PRODUCT acetyltransferase, GNAT family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 227029..227724 GB:FROM 227029 GB:TO 227724 GB:DIRECTION + GB:PRODUCT acetyltransferase, GNAT family GB:NOTE identified by match to protein family HMM PF00583 GB:PROTEIN_ID ACF56867.1 GB:DB_XREF GI:194358419 LENGTH 231 SQ:AASEQ MPVNEYGQMIGESMEGYTPGELPSIDFLEGRYARIEALSVEKHAEDLLAVYGPDTPQEMWTYLFQEPVADMGELVSLLHQMLARKDRFYYAIIDKATGKALGSFSLMRIDQNNRVIEVGAVTFSPELRGTRIGTEAQYLLARYVFEELNYRRYEWKCDALNLPSRRAAERLSFIYEGTFRQAVVYKGRTRDTDWLSMIDKDWPQVKDRLETWLRPENFDKNGQQYKSLREL GT:EXON 1|1-231:0| BL:SWS:NREP 1 BL:SWS:REP 3->228|YIW2_YEAST|2e-60|49.1|224/236| BL:PDB:NREP 1 BL:PDB:REP 29->213|2z0zA|2e-17|36.4|176/194| RP:PDB:NREP 1 RP:PDB:REP 84->198|3dnsA|2e-21|15.6|109/126| HM:PFM:NREP 1 HM:PFM:REP 96->173|PF00583|3.7e-09|27.3|77/83|Acetyltransf_1| RP:SCP:NREP 1 RP:SCP:REP 41->198|2fckA1|3e-31|19.4|155/174|d.108.1.1| HM:SCP:REP 22->199|2fckA1|5e-41|35.3|173/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 435 OP:NHOMOORG 365 OP:PATTERN -------------------------------------------------------------------- -21-2--1111----------1---1------1----111--1-1--11---1111-2------11--11------------------------------111-1------------------------------------------------------------------------------22111------11111211-111112-111--111---21--------121-----------------111-------------------------111----11111111111111-------------1--221-----------------------------------------------2-1----2--1112-------111111111111111111-111---1--2-1111-11111111111111111-2111111-1--------111-1-1------------------------------------111-22222222111122211111-12211111--22111111211121-11-1--211111111--1------------1------------------11-----------------------------11---12-----111121111111111112-------------1211121------------------------------222--111----------------2---------111111-11111----121111111---1-1111-----------1111111--1--11111212111111111------------1-------------------------------1133-----------------------------------------1-11--1- ----11------111-2--1111111-111111----11111111111111121-1------1---11-------21-621--------1--2--1------11---1-1---------------------------------------------------------------1-----------1--2---115134- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 202 STR:RPRED 87.4 SQ:SECSTR ############################EccccEEEEcccGGGHHHHTTcccccccTTHHHHHHHHHHTTccHHHHHHHHHHcTTcTTEEEEEETETccEEEEEEEEEEETTTTEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEEEETTTTcccHHHHHTTcEEEEEEEEEEEETTEEEEEEEEEEHccccEEEETTEEEcccHHHHHHHcGGGEEEEE# DISOP:02AL 227-232| PSIPRED ccccccccEEccccccccccccccccEEEccEEEEEEccHHHcHHHHHHHHcccccHHHHHHccccccccHHHHHHHHHHHHHccccEEEEEEEccccEEEEEEEEEEccccccEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHcccEEEEEEEccEEEccEEEEEEEEEEEHHHHHHHHHHHHHHccHHHcccccccccccccc //