[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56872.1
DDBJ      :             conserved domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.109.1
:59 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->59 2vyuA PDBj 1e-20 95.0 %
:RPS:SCOP  19->58 2bibA1  b.109.1.1 * 2e-08 37.5 %
:HMM:SCOP  20->58 2bibA1 b.109.1.1 * 4e-10 53.8 %
:HMM:PFM   22->39 PF01473 * CW_binding_1 1.3e-08 55.6 18/19  
:BLT:SWISS 31->58 LYTB_STRR6 3e-05 50.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56872.1 GT:GENE ACF56872.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 340966..341145 GB:FROM 340966 GB:TO 341145 GB:DIRECTION + GB:PRODUCT conserved domain protein GB:NOTE identified by match to protein family HMM PF01473 GB:PROTEIN_ID ACF56872.1 GB:DB_XREF GI:194358424 LENGTH 59 SQ:AASEQ MLPHDFPLYLTVWSFFRRSMTTGWFQVNGRWYYAYSSGALAVNTTVDGYSVNYNGEWVQ GT:EXON 1|1-59:0| BL:SWS:NREP 1 BL:SWS:REP 31->58|LYTB_STRR6|3e-05|50.0|28/702| BL:PDB:NREP 1 BL:PDB:REP 20->59|2vyuA|1e-20|95.0|40/300| HM:PFM:NREP 1 HM:PFM:REP 22->39|PF01473|1.3e-08|55.6|18/19|CW_binding_1| RP:SCP:NREP 1 RP:SCP:REP 19->58|2bibA1|2e-08|37.5|40/232|b.109.1.1| HM:SCP:REP 20->58|2bibA1|4e-10|53.8|39/0|b.109.1.1|1/1|Cell wall binding repeat| OP:NHOMO 84 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------77778885776---------------------------5---------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 48 STR:RPRED 81.4 SQ:SECSTR ###########EEEEEcTccccEEEEETTEEEEEcTTccccccEEETTEEEcTTccEEc DISOP:02AL 1-2| PSIPRED cccccccHHHHHHHHHHccccEEEEEEccEEEEEEccccEEEEEEEEEEEEcccccccc //