[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : accB
DDBJ      :accB         acetyl-CoA carboxylase, bitoin carboxyl carrier protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  689/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
b.84.1
:161 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   85->161 3bdoA PDBj 2e-16 49.4 %
:RPS:PDB   9->161 3cdxA PDBj 1e-13 11.8 %
:RPS:SCOP  85->161 1bdoA  b.84.1.1 * 2e-12 49.4 %
:HMM:SCOP  82->161 1bdoA_ b.84.1.1 * 1.4e-21 46.2 %
:RPS:PFM   88->154 PF00364 * Biotin_lipoyl 6e-07 47.0 %
:HMM:PFM   88->160 PF00364 * Biotin_lipoyl 1.1e-24 45.8 72/74  
:BLT:SWISS 1->161 BCCP_STRP6 3e-42 55.9 %
:PROS 117->134|PS00188|BIOTIN
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55420.1 GT:GENE accB GT:PRODUCT acetyl-CoA carboxylase, bitoin carboxyl carrier protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 380803..381288 GB:FROM 380803 GB:TO 381288 GB:DIRECTION + GB:GENE accB GB:PRODUCT acetyl-CoA carboxylase, bitoin carboxyl carrier protein GB:NOTE identified by match to protein family HMM PF00364; match to protein family HMM TIGR00531 GB:PROTEIN_ID ACF55420.1 GB:DB_XREF GI:194356972 GB:GENE:GENE accB LENGTH 161 SQ:AASEQ MNLNDIKDLMTQFDQSSLREFSYKNGTDELQFSKNEARPVPEVATQVAPAPVLATPSPVAPTSAPAETVAEEVPAPAEASVASEGNLVESPLVGVVYLAAGPDKPAFVTVGDSVKKGQTLVIIEAMKVMNEIPAPKDGVVTEILVSNEEMVEFGKGLVRIK GT:EXON 1|1-161:0| BL:SWS:NREP 1 BL:SWS:REP 1->161|BCCP_STRP6|3e-42|55.9|161/166| PROS 117->134|PS00188|BIOTIN|PDOC00167| SEG 54->84|atpspvaptsapaetvaeevpapaeasvase| BL:PDB:NREP 1 BL:PDB:REP 85->161|3bdoA|2e-16|49.4|77/82| RP:PDB:NREP 1 RP:PDB:REP 9->161|3cdxA|1e-13|11.8|144/329| RP:PFM:NREP 1 RP:PFM:REP 88->154|PF00364|6e-07|47.0|66/74|Biotin_lipoyl| HM:PFM:NREP 1 HM:PFM:REP 88->160|PF00364|1.1e-24|45.8|72/74|Biotin_lipoyl| RP:SCP:NREP 1 RP:SCP:REP 85->161|1bdoA|2e-12|49.4|77/80|b.84.1.1| HM:SCP:REP 82->161|1bdoA_|1.4e-21|46.2|80/80|b.84.1.1|1/1|Single hybrid motif| OP:NHOMO 744 OP:NHOMOORG 702 OP:PATTERN ------------------------------------------------------1---222------- 111-1----------------------------------1-11-----------------11---1-------------222111111---1----1--111111111111111111111111111111111111111111---1111111111111111111111111111-11111-111111111111111111111111111111111111111111111111111111211111111111111111121-111112-1-11111111112111111111111111111111111111111111111111111111111--111111111-1111111111111----1-111111111111------1111111111111112111111111111111111111-1111121111113112212222111111111111111212222222211111111-----------------------------11111122221111111111111111111111111111111112111111111121111111111111111111111-1-------------11111--11111111--11-11111111111111111-111-111111111111-1-----------1----111-11111------11111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111212111111111111111122111111111111111111111111111111111111111111-----11--------1-------------------------------------11- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111-------1-12-21------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 153 STR:RPRED 95.0 SQ:SECSTR ########cEEEEccccHHHHHHHTTcEEEEEEcccTTcccHHHHHHHHHHHHHHHHHTTccccccccccTTcccccEEEEcccGGGEEEccccEEEEEccEEEEEcccTTcEEcTTcEEEEEEcTcccEEEEccccEEEEEEEEEcccEEcTTcEEEEEE DISOP:02AL 40-87| PSIPRED ccHHHHHHHHHHHHHccccEEEEEcccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccEEEEccccccccEEccccEEccccEEEEEEcccEEEEEEcccccEEEEEEcccccccccccEEEEEc //