[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : accD
DDBJ      :accD         acetyl-CoA carboxylase beta subunit
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  821/915 : Eukaryota  49/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:288 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->283 2f9iB PDBj 2e-76 52.0 %
:RPS:PDB   23->275 3buzA PDBj 2e-44 9.9 %
:RPS:SCOP  33->287 2f9yB1  c.14.1.4 * 5e-67 42.9 %
:HMM:SCOP  33->290 2f9yB1 c.14.1.4 * 5.4e-71 35.3 %
:RPS:PFM   63->277 PF01039 * Carboxyl_trans 7e-36 45.4 %
:HMM:PFM   100->244 PF01039 * Carboxyl_trans 2.2e-19 27.3 143/493  
:HMM:PFM   36->62 PF10571 * UPF0547 1.4e-05 34.8 23/26  
:BLT:SWISS 6->284 ACCD_CLOBB 1e-87 55.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55164.1 GT:GENE accD GT:PRODUCT acetyl-CoA carboxylase beta subunit GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 383123..383989 GB:FROM 383123 GB:TO 383989 GB:DIRECTION + GB:GENE accD GB:PRODUCT acetyl-CoA carboxylase beta subunit GB:NOTE identified by match to protein family HMM TIGR00515 GB:PROTEIN_ID ACF55164.1 GB:DB_XREF GI:194356716 GB:GENE:GENE accD LENGTH 288 SQ:AASEQ MALFSKKDKYIRINPNRSVREKPQAKPEVPDELFSQCPGCKHTIYQKDLGSERICPHCSYTFRISAQERLALTIDMGTFKELFTGIESKDPLHFPGYQKKLASMREKTGLHEAVVTGTALIKGQTVALGIMDSNFIMASMGTVVGEKITRLFEYATVEKLPVVLFTASGGARMQEGIMSLMQMAKISAAVKRHSNAGLFYLTILTDPTTGGVTASFAMEGDIILAEPQSLVGFAGRRVIENTVRESLPEDFQKAEFLLEHGFVDAIVKRRDLPDTIASLVRLHGGSPR GT:EXON 1|1-288:0| BL:SWS:NREP 1 BL:SWS:REP 6->284|ACCD_CLOBB|1e-87|55.6|279/291| BL:PDB:NREP 1 BL:PDB:REP 30->283|2f9iB|2e-76|52.0|254/260| RP:PDB:NREP 1 RP:PDB:REP 23->275|3buzA|2e-44|9.9|232/413| RP:PFM:NREP 1 RP:PFM:REP 63->277|PF01039|7e-36|45.4|194/454|Carboxyl_trans| HM:PFM:NREP 2 HM:PFM:REP 100->244|PF01039|2.2e-19|27.3|143/493|Carboxyl_trans| HM:PFM:REP 36->62|PF10571|1.4e-05|34.8|23/26|UPF0547| GO:PFM:NREP 1 GO:PFM GO:0016874|"GO:ligase activity"|PF01039|IPR000022| RP:SCP:NREP 1 RP:SCP:REP 33->287|2f9yB1|5e-67|42.9|252/257|c.14.1.4| HM:SCP:REP 33->290|2f9yB1|5.4e-71|35.3|258/0|c.14.1.4|1/1|ClpP/crotonase| OP:NHOMO 1089 OP:NHOMOORG 885 OP:PATTERN ------11-------11-------1111--1-----------------------111--1------11 23412233222-3112322-22111322222121113422-112111211111211-1112211-321321-111111-111311111111212--1--11111121222111111111111111223232132322335511122111111111111111111111111111111111111121222111122111111111111111122222111222311111111121111111111111111111111-111111-1-22111111111111111111111111111111111111111111111111211111111-2211111111111121111111111--1211111211111211121-11111111111111121111211211222122111122-11211111221122222222232221312212222222111111111111112131111-1111---11111111111111111122211111111111111111111111111-1111111122111221111122221131111111111111111112111111111121111111111113222221111111111111111111111111111111111111111--------------------1-11111------11111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111122122111111111111111111--------------1-1-------------------------11111-111111- ------1-1--1--1-----------------------------------------------------------------------------------------11-12111--------1-1-11-2-571-111-1--1-11-11---1--2----312---1------1211211------1---3--1--11112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 282 STR:RPRED 97.9 SQ:SECSTR ###ccccccccc##ccccccccccccccccTTcHHHHHHHHHHHHHHHHHcHHHHHHHHHTTHccHHHHHHHHHHHHTHHHHHHHHHcGGGcTccHHHHHTcHHHHHHHHHHHHHHHccccccEEEEEEEGGGGTcccccccTTcccccHHHHHHHHHHccEEEEEEEccEEEEEEEEEEccccccTTcccccEEEEEcTTcccEEEEETTEEEEEEEEEEEEEEEEEEEEEETTEEEEEEEEEEEcccccTTcHHHHHHHHHHHHTTHHHHccTHHHHHHccccTT# DISOP:02AL 1-1,12-30,288-289| PSIPRED cccccccccccccccccccccccccccccccccEEEccccccccEEHHHccccccHHccccccccHHHHHHHHccccccccccccccccccccccccccccHHccccccccccEEEEEEEEccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHccEEEEEcccEEEEEcHHHHHHHHcccccccccHHHHHHHcccccEEEcHHHHHHHHHHHHHHHHcccc //