[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : acpS
DDBJ      :acpS         holo-(acyl-carrier-protein) synthase
Swiss-Prot:ACPS_STRZT   RecName: Full=Holo-[acyl-carrier-protein] synthase;         Short=Holo-ACP synthase;         EC=2.7.8.7;AltName: Full=4'-phosphopantetheinyl transferase acpS;

Homologs  Archaea  0/68 : Bacteria  250/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.150.1
:120 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->117 1fthA PDBj 3e-63 99.1 %
:RPS:PDB   2->117 2bddA PDBj 8e-28 28.6 %
:RPS:SCOP  2->115 1f7lA  d.150.1.2 * 8e-29 44.7 %
:HMM:SCOP  1->117 1fthA_ d.150.1.2 * 4e-34 45.3 %
:RPS:PFM   6->68 PF01648 * ACPS 3e-08 41.0 %
:HMM:PFM   6->70 PF01648 * ACPS 5.5e-21 46.2 65/70  
:BLT:SWISS 1->120 ACPS_STRZT 2e-65 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56122.1 GT:GENE acpS GT:PRODUCT holo-(acyl-carrier-protein) synthase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1552831..1553193) GB:FROM 1552831 GB:TO 1553193 GB:DIRECTION - GB:GENE acpS GB:PRODUCT holo-(acyl-carrier-protein) synthase GB:NOTE identified by match to protein family HMM PF01648; match to protein family HMM TIGR00516; match to protein family HMM TIGR00556 GB:PROTEIN_ID ACF56122.1 GB:DB_XREF GI:194357674 GB:GENE:GENE acpS LENGTH 120 SQ:AASEQ MIVGHGIDIEELASIESAVTRHEGFAKRVLTAQEMERFTSLKGRRQIEYLAGRWSAKEAFSKAMGTGISKLGFQDLEVLNNERGAPYFSQAPFSGKIWLSISHTDQFVTASVILEENHES GT:EXON 1|1-120:0| SW:ID ACPS_STRZT SW:DE RecName: Full=Holo-[acyl-carrier-protein] synthase; Short=Holo-ACP synthase; EC=2.7.8.7;AltName: Full=4'-phosphopantetheinyl transferase acpS; SW:GN Name=acpS; OrderedLocusNames=SPT_1637; SW:KW Complete proteome; Cytoplasm; Fatty acid biosynthesis;Lipid synthesis; Magnesium; Metal-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->120|ACPS_STRZT|2e-65|100.0|120/120| GO:SWS:NREP 5 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006633|"GO:fatty acid biosynthetic process"|Fatty acid biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 1->117|1fthA|3e-63|99.1|117/117| RP:PDB:NREP 1 RP:PDB:REP 2->117|2bddA|8e-28|28.6|112/127| RP:PFM:NREP 1 RP:PFM:REP 6->68|PF01648|3e-08|41.0|61/67|ACPS| HM:PFM:NREP 1 HM:PFM:REP 6->70|PF01648|5.5e-21|46.2|65/70|ACPS| GO:PFM:NREP 3 GO:PFM GO:0000287|"GO:magnesium ion binding"|PF01648|IPR008278| GO:PFM GO:0008897|"GO:holo-[acyl-carrier-protein] synthase activity"|PF01648|IPR008278| GO:PFM GO:0009059|"GO:macromolecule biosynthetic process"|PF01648|IPR008278| RP:SCP:NREP 1 RP:SCP:REP 2->115|1f7lA|8e-29|44.7|114/118|d.150.1.2| HM:SCP:REP 1->117|1fthA_|4e-34|45.3|117/117|d.150.1.2|1/1|4'-phosphopantetheinyl transferase| OP:NHOMO 254 OP:NHOMOORG 253 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1---------------------------1-----------------111--1--1111--------------------------------------------------------1111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111---1-1111111111-1111111-------------1--11-1111--11------------------------------------------------------------------------------------------------------111111111111111----------1----------1--------------11-11-------11----1----11--------------11----------1-1------111---1-----------1--1----------------11-1-----1---11--1--------------------------------1--------------------1-------1-----1-----11111--------1----1----------1-----------1--1-------------1-----------------------------------------------------111111111111111---------------1------------------1-1----------1------------1--111-111--- ----11-------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 98.3 SQ:SECSTR cEEEEEEEEEEHHHHHHHHHHcTTHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHTTcccTcGGGGGEEEEEcTTccEEEEEcHHHcEEEEEEEEEccEEEEEEEEEEEc## DISOP:02AL 118-121| PSIPRED cEEEEEEEEEEcHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEcccccEEEEEcccccEEEEEEEccccEEEEEEEEEccccc //