[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : aliA
DDBJ      :aliA         ABC transporter substrate-binding protein - oligopeptide transport
Swiss-Prot:ALIA_STRPN   RecName: Full=Oligopeptide-binding protein aliA;AltName: Full=Exported protein 1;Flags: Precursor;

Homologs  Archaea  5/68 : Bacteria  480/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:660 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->358 2z23A PDBj 7e-27 31.1 %
:RPS:PDB   34->598 3dp8B PDBj 3e-49 15.2 %
:RPS:SCOP  32->598 1uqwA  c.94.1.1 * 3e-50 18.4 %
:HMM:SCOP  27->598 1jetA_ c.94.1.1 * 2.1e-72 26.9 %
:RPS:PFM   76->522 PF00496 * SBP_bac_5 4e-21 31.0 %
:HMM:PFM   77->520 PF00496 * SBP_bac_5 1.5e-54 25.6 356/372  
:BLT:SWISS 31->660 ALIA_STRPN 0.0 98.9 %
:PROS 82->104|PS01040|SBP_BACTERIAL_5
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56247.1 GT:GENE aliA GT:PRODUCT ABC transporter substrate-binding protein - oligopeptide transport GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 320052..322034 GB:FROM 320052 GB:TO 322034 GB:DIRECTION + GB:GENE aliA GB:PRODUCT ABC transporter substrate-binding protein - oligopeptide transport GB:NOTE identified by match to protein family HMM PF00496 GB:PROTEIN_ID ACF56247.1 GB:DB_XREF GI:194357799 GB:GENE:GENE aliA LENGTH 660 SQ:AASEQ MKSSKLLALAGVTLLAATTLAACSGSGSSTKGEKTLSYIYETDPDNLNYLTTAKAATANITSNVVDGLLENDRYGNFVPSMAEDWSVSKDGLTYTYTIRKDAKWYTSEGEEYAAVKAQDFVTGLKYAADKKSDALYLVQESIKGLDAYVKGEIKDFSQVGIKALDDQTVQYTLNKPESFWNSKTTMGVLAPVNEEFLNSKGDDFAKATDPSSLLYNGPYLLKSIVTKSSVEFAKNPNYWDKDNVHIDKVKLSFWDGQDTSKPAENFKDGSLTAARLYPTSASFAELEKSMKDNIVYTQQDSITYLVGTNIDRQSYKYTSKTSDEQKASTKKALLNKDFRQAIAFGFDRTAYASQLNGQTGASKILRNLFVPPTFVQADGKNFGDMVKEKLVTYGDEWKDVNLADSQDGLYNPEKAKAEFAKAKSALQAEGVTFPIHLDMPVDQTATTKVQRVQSMKQSLEATLGADNVIIDIQQLQKDEVNNITYFAENAAGEDWDLSDNVGWGPDFADPSTYLDIIKPSVGESTKTYLGFDSGEDNVAAKKVGLYDYEKLVTEAGDEATDVAKRYDKYAAAQAWLTDSALIIPTTSRTGRPILSKMVPFTIPFALSGNKGTSEPILYKYLELQDKAVTVDXYQKAQEKWMKEKEESNKKAQEDLAKHVK GT:EXON 1|1-660:0| SW:ID ALIA_STRPN SW:DE RecName: Full=Oligopeptide-binding protein aliA;AltName: Full=Exported protein 1;Flags: Precursor; SW:GN Name=aliA; Synonyms=exp1, plpA; OrderedLocusNames=SP_0366; SW:KW Cell membrane; Complete proteome; Lipoprotein; Membrane; Palmitate;Peptide transport; Protein transport; Signal; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 31->660|ALIA_STRPN|0.0|98.9|630/660| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0015833|"GO:peptide transport"|Peptide transport| GO:SWS GO:0015031|"GO:protein transport"|Protein transport| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 82->104|PS01040|SBP_BACTERIAL_5|PDOC00799| SEG 6->29|llalagvtllaattlaacsgsgss| SEG 413->423|ekakaefakak| BL:PDB:NREP 1 BL:PDB:REP 42->358|2z23A|7e-27|31.1|286/517| RP:PDB:NREP 1 RP:PDB:REP 34->598|3dp8B|3e-49|15.2|474/497| RP:PFM:NREP 1 RP:PFM:REP 76->522|PF00496|4e-21|31.0|361/366|SBP_bac_5| HM:PFM:NREP 1 HM:PFM:REP 77->520|PF00496|1.5e-54|25.6|356/372|SBP_bac_5| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF00496|IPR000914| GO:PFM GO:0006810|"GO:transport"|PF00496|IPR000914| RP:SCP:NREP 1 RP:SCP:REP 32->598|1uqwA|3e-50|18.4|468/487|c.94.1.1| HM:SCP:REP 27->598|1jetA_|2.1e-72|26.9|483/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 1439 OP:NHOMOORG 489 OP:PATTERN 11---------------------1---------------------------11--------------- -------1-----------------2------------------11--1-----------1--------1--111121----1---11------------------1--11------2433333----------1-13311111241111111----------12-2--21------------2----22-222BCDCECDD9DDECCD3-2232EDE2123354433335J211111112111111111111C7A6575--2-77--66222243332222222241134444444444-1111111111115--762---21-1522222222223111132223-2111-1--22--------2251-26------------21228------1-22222222227-1131131124--76641214441222--2-133233-1---------------62-----------------------------------111212333321333322333333232172112------------1124-1-----41----------------------------1---11--1-------1-1--------1111111111-------44---2---1------1-----------11--1----------45544544444443434-4443444343444444443555656643323333333333334622433334-433333333333---------------312443-22-33324-34111-11--14114344113333334-4431-11-11---11222222223211-----------------G------555252122--------------------------------2121114- -------------1------------------------------------------------------------------------------------------------------------------------------------------------1----1---------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 566 STR:RPRED 85.8 SQ:SECSTR ##############################ccccEEEEEEccccccccTTcccTTccHHHHHHHccccEEEcTTccEEEccEEEEEEcTTccEEEEEEccccccTTTTccccccccHHHHHHHHHHHHTTGGGGTTHHHTTccHHHHHEETcccGcGGcEEEEccccEEEEEEccccTTHHHHHTcccccccccGGGccccccTTcccccTcccccccEEEEEEETTTEEEEEEcTTcccccGccccEEEEEEEEcccHHHHHHHHHTTcccEEEEETTcccHHHHHHTcTTcEEEEccccEEEEEEEcTTcTTTTTTEEEccccHHTTcTTTTcHHHHHHHHHHccHHHHHHTTTcccccEEccccccccTTcTTccccccccccHHHHHHHHHHTTccccTTHHHHHcHHHHHHH##HHHHHTTccccccEETTEEcEEEEEEETTcHHHHHHHHHHHHHHHTTTcEEEEEEEcHHHEcHHHHHHHHHHHTcccEEEEEEcccTTTTTHHHHHGGGccccHHHHHTTTcccHHccTTcccTTHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHTTcEEEEEEEcEEEEEcGGG############################################################## DISOP:02AL 1-4,23-35,641-655,659-661| PSIPRED ccHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEcccccccccEEEcccHHHHHHHHHHHHHEEEcccccEEEccEEEEEEcccccEEEEEEccccEEEcccccccccccHHHHHHHHHHHHcccccccHHHHHHHccHHHHHHcccccccccEEEEccccEEEEEEccccHHHHHHHHHHHHHcccHHHHHHccccccccccccccEEEccEEEEEEEcccEEEEEEcccccccccccEEEEEEEEEEcccHHHHHHHHHcccEEEEEccccHHHHHHHHHcccccEEEEccccEEEEEEEEccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccHHHcccccccEEEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEEEEEccccHHHHHHHHHHccccccEEEEEEccccccccHHHHHHHHccccccccccccccccccccccHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccEEEEEEEccEEEEEccccEEcccccccccccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //