[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : argR1
DDBJ      :argR1        arginine repressor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  245/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.74.2
:156 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->139 1f9nB PDBj 1e-23 39.9 %
:RPS:PDB   4->49 2ahqA PDBj 8e-08 17.4 %
:RPS:PDB   82->148 1b4bA PDBj 2e-16 32.8 %
:RPS:SCOP  7->76 1b4aA1  a.4.5.3 * 3e-17 41.4 %
:RPS:SCOP  82->148 1b4bA  d.74.2.1 * 1e-16 32.8 %
:HMM:SCOP  1->74 1aoyA_ a.4.5.3 * 1.7e-17 39.2 %
:HMM:SCOP  79->149 1b4bA_ d.74.2.1 * 6e-17 31.0 %
:RPS:PFM   3->61 PF01316 * Arg_repressor 2e-10 50.8 %
:RPS:PFM   94->147 PF02863 * Arg_repressor_C 5e-10 40.7 %
:HMM:PFM   5->66 PF01316 * Arg_repressor 9.3e-25 48.4 62/70  
:HMM:PFM   80->148 PF02863 * Arg_repressor_C 6.6e-22 31.9 69/70  
:BLT:SWISS 1->156 ARGR_STRSU 7e-58 64.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56852.1 GT:GENE argR1 GT:PRODUCT arginine repressor GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(794221..794691) GB:FROM 794221 GB:TO 794691 GB:DIRECTION - GB:GENE argR1 GB:PRODUCT arginine repressor GB:NOTE identified by match to protein family HMM PF01316; match to protein family HMM PF02863 GB:PROTEIN_ID ACF56852.1 GB:DB_XREF GI:194358404 GB:GENE:GENE argR1 LENGTH 156 SQ:AASEQ MNKSEHRHQLIRALITKNKIHTQAELQALLAKNDIQVTQATLSRDIKNMNLSKVREEDSAYYVLNNGSISKWEKRLELYMEDALVWMRPVQHQVLLKTLPGLAQSFGSIIDTLSFPDAIATLCGNDVCLIICEDADTAQKCFEELKKFAPPFFFEE GT:EXON 1|1-156:0| BL:SWS:NREP 1 BL:SWS:REP 1->156|ARGR_STRSU|7e-58|64.7|156/157| BL:PDB:NREP 1 BL:PDB:REP 1->139|1f9nB|1e-23|39.9|138/149| RP:PDB:NREP 2 RP:PDB:REP 4->49|2ahqA|8e-08|17.4|46/67| RP:PDB:REP 82->148|1b4bA|2e-16|32.8|67/71| RP:PFM:NREP 2 RP:PFM:REP 3->61|PF01316|2e-10|50.8|59/69|Arg_repressor| RP:PFM:REP 94->147|PF02863|5e-10|40.7|54/70|Arg_repressor_C| HM:PFM:NREP 2 HM:PFM:REP 5->66|PF01316|9.3e-25|48.4|62/70|Arg_repressor| HM:PFM:REP 80->148|PF02863|6.6e-22|31.9|69/70|Arg_repressor_C| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01316|IPR001669| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01316|IPR001669| GO:PFM GO:0003700|"GO:transcription factor activity"|PF02863|IPR001669| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF02863|IPR001669| RP:SCP:NREP 2 RP:SCP:REP 7->76|1b4aA1|3e-17|41.4|70/75|a.4.5.3| RP:SCP:REP 82->148|1b4bA|1e-16|32.8|67/72|d.74.2.1| HM:SCP:REP 1->74|1aoyA_|1.7e-17|39.2|74/0|a.4.5.3|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 79->149|1b4bA_|6e-17|31.0|71/71|d.74.2.1|1/1|C-terminal domain of arginine repressor| OP:NHOMO 324 OP:NHOMOORG 245 OP:PATTERN -------------------------------------------------------------------- 111--11111111111111-1111-111111-11111-11-11111-11---1111-1--111111211111111111-1----------11-1-------------------------------111-1-------------------------------------------------------111---111111112212112221112211221111111111111111122222222222222111114-2-22-2---22222221112-111222222121122223322232212222222222122211122221-111---11-11111-111111111-1111111111111-1111111--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 148 STR:RPRED 94.9 SQ:SECSTR cccHHHHHHHHHHHHHHcccccHHHHHHHHHHTTccccHHHHHHHHHHTTcEEEEccccEEEEcTTcccccHHHHHHHHHHHHEEEEEEETTEEEEEEcTTcHHHHHHHHHHHccTTEEEEEEcccEEEEEEccHHHHHHHHHHHHTT######## DISOP:02AL 1-5,67-77,156-157| PSIPRED cccHHHHHHHHHHHHHHcccccHHHHHHHHHHcccEEcHHHHHHHHHHccEEEEEcccccEEEEcccccccHHHHHHHHHHHHHHEEEccccEEEEEEccccHHHHHHHHHHcccccEEEEEccccEEEEEEccHHHHHHHHHHHHHHcccccccc //