[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : asd
DDBJ      :asd          aspartate-semialdehyde dehydrogenase
Swiss-Prot:             

Homologs  Archaea  44/68 : Bacteria  718/915 : Eukaryota  48/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.81.1
:358 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->358 2gz1A PDBj e-176 99.4 %
:RPS:PDB   17->341 1brmC PDBj 3e-30 18.8 %
:RPS:SCOP  17->155 2gyyA1  c.2.1.3 * 5e-31 73.9 %
:RPS:SCOP  128->329 2gyyA2  d.81.1.1 * 4e-25 91.1 %
:HMM:SCOP  2->154 2g17A1 c.2.1.3 * 4.9e-52 50.7 %
:HMM:SCOP  127->329 1brmA2 d.81.1.1 * 1.5e-75 46.8 %
:RPS:PFM   29->118 PF01118 * Semialdhyde_dh 2e-07 36.0 %
:RPS:PFM   137->328 PF02774 * Semialdhyde_dhC 2e-19 40.5 %
:HMM:PFM   137->328 PF02774 * Semialdhyde_dhC 6.1e-56 40.8 179/184  
:HMM:PFM   4->118 PF01118 * Semialdhyde_dh 1.2e-32 38.6 114/121  
:BLT:SWISS 17->358 DHAS_STRMU e-150 75.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56181.1 GT:GENE asd GT:PRODUCT aspartate-semialdehyde dehydrogenase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 905020..906096 GB:FROM 905020 GB:TO 906096 GB:DIRECTION + GB:GENE asd GB:PRODUCT aspartate-semialdehyde dehydrogenase GB:NOTE identified by match to protein family HMM PF01118; match to protein family HMM PF02774; match to protein family HMM TIGR01296 GB:PROTEIN_ID ACF56181.1 GB:DB_XREF GI:194357733 GB:GENE:GENE asd LENGTH 358 SQ:AASEQ MGYTVAVVGATGAVGAQMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDITIEETTETAFEGVDIALFSAGSSTSAXYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHNGIIACPNCSTIQMMVALEPVRQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGVKPRDLHAEILPSGGDKKHYPIAFNALPQIDVFTDNDYTYEEMKMTKETKKIMEDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAVLEDDVAHQIYPQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLVRPTAELKFELK GT:EXON 1|1-358:0| BL:SWS:NREP 1 BL:SWS:REP 17->358|DHAS_STRMU|e-150|75.7|342/358| SEG 2->16|gytvavvgatgavga| SEG 52->60|itieettet| SEG 217->233|ytyeemkmtketkkime| BL:PDB:NREP 1 BL:PDB:REP 17->358|2gz1A|e-176|99.4|342/357| RP:PDB:NREP 1 RP:PDB:REP 17->341|1brmC|3e-30|18.8|325/359| RP:PFM:NREP 2 RP:PFM:REP 29->118|PF01118|2e-07|36.0|89/120|Semialdhyde_dh| RP:PFM:REP 137->328|PF02774|2e-19|40.5|163/165|Semialdhyde_dhC| HM:PFM:NREP 2 HM:PFM:REP 137->328|PF02774|6.1e-56|40.8|179/184|Semialdhyde_dhC| HM:PFM:REP 4->118|PF01118|1.2e-32|38.6|114/121|Semialdhyde_dh| GO:PFM:NREP 8 GO:PFM GO:0005737|"GO:cytoplasm"|PF01118|IPR000534| GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF01118|IPR000534| GO:PFM GO:0016620|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor"|PF01118|IPR000534| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF01118|IPR000534| GO:PFM GO:0005737|"GO:cytoplasm"|PF02774|IPR012280| GO:PFM GO:0008652|"GO:cellular amino acid biosynthetic process"|PF02774|IPR012280| GO:PFM GO:0016620|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor"|PF02774|IPR012280| GO:PFM GO:0046983|"GO:protein dimerization activity"|PF02774|IPR012280| RP:SCP:NREP 2 RP:SCP:REP 17->155|2gyyA1|5e-31|73.9|134/150|c.2.1.3| RP:SCP:REP 128->329|2gyyA2|4e-25|91.1|202/202|d.81.1.1| HM:SCP:REP 2->154|2g17A1|4.9e-52|50.7|152/0|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 127->329|1brmA2|1.5e-75|46.8|203/0|d.81.1.1|1/1|Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain| OP:NHOMO 888 OP:NHOMOORG 810 OP:PATTERN ---1---111111111--1111111111111111111111111----1-11111------1---1--1 1111211111111111111-11111111111111111111121111111111------1122111112221-111---11111111111111111111111111111111---------------11111111111-----111-111111111111111111111111111111111111111111111111122222222122222211111122211111111111111-1111111111111111111111-1111111-121111--1111111111111111111111111111-------------1111111111111-11111111111-1111111-11-11--11111111121111111-1111222111111112221111111111111111111-111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111------------------------------------------------------1-11---1---111---1--1-1111111111212-1-1111121211211111111111111111111111111122111-111111111111111111111111---11111--11111112111111111111-1111111111111111111111112121111111111111111111111111-111111111111--2111111111112-1-111-1----11---1-------11-1-11111111111111111111--111112222222222222211111111111111111111--------------1-------------------------1111111111111 ------1-----11------------------------------------------------1---1-111111111-11111-11---------1--------1---1----------------------------------------------------------------1-1111E112111113-111121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 342 STR:RPRED 95.5 SQ:SECSTR ################HHHHHHHHHTGGcEEEEEcccccTTcccccTTccccccccTTcHHHHTccEEEEcccHHHHHHHHHHHHTcccEEEEcccTTTTcTTEEEEcHHHHHHHHHTTccEEEEccHHHHHHHHHHHHHHTTTcEEEEEEEEEEccTTTcHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHTTTcccccTTTccccTTcccccccccccccHHHHHHHTTcccccEEEEEEEcccccEEEEEEEEEEcccccHHHHHHHHHHHcTTccccHHHHHHHccHHHHTTcccccEEEEEEcTTcTTEEEEEEEEETTcccccHHHHHHHHHHHHHHHHHHHTTcccccc DISOP:02AL 1-1| PSIPRED ccEEEEEEEcccHHHHHHHHHHHHccccEEEEEEEEccccccEEEEEcccEEEEccccHHHcccccEEEEccccHHHHHHHHHHHHcccEEEEcccccccccccEEEEccccHHHHcccccEEEcccHHHHHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHHHHHcccccHHHHHHcccccccccccccHHHHcccccccccccccHHHHHHHHHHHHHHHccccccEEEEEEEccccccEEEEEEEEEcccccHHHHHHHHHHccccEEEEcccccccccEEEEcccccEEEEEEEEccccccEEEEEEEEEccccHHHHHHHHHHHHHHHccccccccccEEEcc //