[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : atpA
DDBJ      :atpA         ATP synthase F0, A chain
Swiss-Prot:ATP6_STRP4   RecName: Full=ATP synthase subunit a;AltName: Full=F-ATPase subunit 6;AltName: Full=ATP synthase F0 sector subunit a;

Homologs  Archaea  2/68 : Bacteria  632/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
f.18.1
:238 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   165->229 1c17M PDBj 4e-08 41.7 %
:RPS:SCOP  74->229 1c17M  f.18.1.1 * 1e-24 23.4 %
:HMM:SCOP  70->230 1c17M_ f.18.1.1 * 3.9e-33 32.7 %
:RPS:PFM   18->229 PF00119 * ATP-synt_A 6e-14 34.0 %
:HMM:PFM   16->230 PF00119 * ATP-synt_A 2.3e-43 34.0 200/215  
:BLT:SWISS 1->238 ATP6_STRP4 e-136 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55344.1 GT:GENE atpA GT:PRODUCT ATP synthase F0, A chain GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1387152..1387868) GB:FROM 1387152 GB:TO 1387868 GB:DIRECTION - GB:GENE atpA GB:PRODUCT ATP synthase F0, A chain GB:NOTE Martin-Galiano, A.J. (2001) Mol.Micr. 41(6), 1327-1338; identified by match to protein family HMM PF00119; match to protein family HMM TIGR01131 GB:PROTEIN_ID ACF55344.1 GB:DB_XREF GI:194356896 GB:GENE:GENE atpA LENGTH 238 SQ:AASEQ MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNILEYVYDFVIGFTEPNIGSRYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLTLSFLVILLTHIESVRRRGFKKSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEVMTSLLLLLSHQAIYWYPVAFGANLAWTAFSVFISCIQAYVFTLLTSVYLGNKINIEEE GT:EXON 1|1-238:0| SW:ID ATP6_STRP4 SW:DE RecName: Full=ATP synthase subunit a;AltName: Full=F-ATPase subunit 6;AltName: Full=ATP synthase F0 sector subunit a; SW:GN Name=atpB; OrderedLocusNames=SPG_1436; SW:KW ATP synthesis; Cell membrane; CF(0); Complete proteome;Hydrogen ion transport; Ion transport; Membrane; Transmembrane;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->238|ATP6_STRP4|e-136|100.0|238/238| GO:SWS:NREP 8 GO:SWS GO:0006754|"GO:ATP biosynthetic process"|ATP synthesis| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0045263|"GO:proton-transporting ATP synthase complex, coupling factor F(o)"|CF(0)| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 5 TM:REGION 10->32| TM:REGION 73->95| TM:REGION 116->134| TM:REGION 166->188| TM:REGION 204->226| BL:PDB:NREP 1 BL:PDB:REP 165->229|1c17M|4e-08|41.7|60/142| RP:PFM:NREP 1 RP:PFM:REP 18->229|PF00119|6e-14|34.0|200/215|ATP-synt_A| HM:PFM:NREP 1 HM:PFM:REP 16->230|PF00119|2.3e-43|34.0|200/215|ATP-synt_A| GO:PFM:NREP 3 GO:PFM GO:0015078|"GO:hydrogen ion transmembrane transporter activity"|PF00119|IPR000568| GO:PFM GO:0015986|"GO:ATP synthesis coupled proton transport"|PF00119|IPR000568| GO:PFM GO:0045263|"GO:proton-transporting ATP synthase complex, coupling factor F(o)"|PF00119|IPR000568| RP:SCP:NREP 1 RP:SCP:REP 74->229|1c17M|1e-24|23.4|137/142|f.18.1.1| HM:SCP:REP 70->230|1c17M_|3.9e-33|32.7|156/171|f.18.1.1|1/1|F1F0 ATP synthase subunit A| OP:NHOMO 676 OP:NHOMOORG 639 OP:PATTERN --------------------------------------------------11---------------- 11--111111111-11111-1111111111111111-1111-11--111-----------11---1111-1---------1-1--111--------1---11-------1--------------121--1112-11---------122-1111111111111121111111111111111111-----111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111-1111-------1-11-11-1111-1--121111111111111--1--11-11----111112---1--1---11------------11-11-1--------1111--11111---11-1-11111111111111----121111-1---------11-111111111111------1111-------12122--11222211--21-11-1--111--111-2----11-1--11------122111-211112-111---1------111----1-21111111111111111111111111111-11-11112-211111121111111111111-1111111-111-1111111-11111111-11111111111111111111111111111111111111111111-11---1111------1------1111111-111--2121111111111111111111111111111111111111111111111111111111112111112121111111111111111--1-----------------1----------------------11-1111111111-11 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------4----1----------31--1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 60 STR:RPRED 25.2 SQ:SECSTR ####################################################################################################################################################################HHHHHHHHHHHHHHHHHHHHHHHHccccHHHH#####HHHHHHHHHHHHHHHHHHHHHHHHHHHc######### DISOP:02AL 1-3,231-231,233-239| PSIPRED cccccccEEEEccEEEHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //