[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : atpC
DDBJ      :atpC         ATP synthase F0, C chain
Swiss-Prot:ATPL_STRZT   RecName: Full=ATP synthase subunit c;AltName: Full=ATP synthase F(0) sector subunit c;AltName: Full=F-type ATPase subunit c;         Short=F-ATPase subunit c;AltName: Full=Lipid-binding protein;

Homologs  Archaea  0/68 : Bacteria  44/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.17.1
:66 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->65 1yceA PDBj 2e-05 39.3 %
:RPS:SCOP  13->65 1ijpA  f.17.1.1 * 7e-10 20.8 %
:HMM:SCOP  1->65 1c99A_ f.17.1.1 * 5.6e-09 29.2 %
:RPS:PFM   6->65 PF00137 * ATP-synt_C 6e-04 28.3 %
:HMM:PFM   6->65 PF00137 * ATP-synt_C 7.8e-14 25.0 56/66  
:BLT:SWISS 1->66 ATPL_STRZT 1e-33 100.0 %
:PROS 31->52|PS00605|ATPASE_C
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56071.1 GT:GENE atpC GT:PRODUCT ATP synthase F0, C chain GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1387903..1388103) GB:FROM 1387903 GB:TO 1388103 GB:DIRECTION - GB:GENE atpC GB:PRODUCT ATP synthase F0, C chain GB:NOTE Martin-Galiano, A.J. (2001) Mol.Micr. 41(6), 1327-1338; identified by match to protein family HMM PF00137 GB:PROTEIN_ID ACF56071.1 GB:DB_XREF GI:194357623 GB:GENE:GENE atpC LENGTH 66 SQ:AASEQ MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLVFSFIIK GT:EXON 1|1-66:0| SW:ID ATPL_STRZT SW:DE RecName: Full=ATP synthase subunit c;AltName: Full=ATP synthase F(0) sector subunit c;AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c;AltName: Full=Lipid-binding protein; SW:GN Name=atpE; OrderedLocusNames=SPT_1450; SW:KW ATP synthesis; Cell membrane; CF(0); Complete proteome;Hydrogen ion transport; Ion transport; Lipid-binding; Membrane;Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->66|ATPL_STRZT|1e-33|100.0|66/66| GO:SWS:NREP 9 GO:SWS GO:0006754|"GO:ATP biosynthetic process"|ATP synthesis| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0045263|"GO:proton-transporting ATP synthase complex, coupling factor F(o)"|CF(0)| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0008289|"GO:lipid binding"|Lipid-binding| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 31->52|PS00605|ATPASE_C|PDOC00526| TM:NTM 2 TM:REGION 2->24| TM:REGION 41->63| BL:PDB:NREP 1 BL:PDB:REP 10->65|1yceA|2e-05|39.3|56/89| RP:PFM:NREP 1 RP:PFM:REP 6->65|PF00137|6e-04|28.3|60/70|ATP-synt_C| HM:PFM:NREP 1 HM:PFM:REP 6->65|PF00137|7.8e-14|25.0|56/66|ATP-synt_C| GO:PFM:NREP 3 GO:PFM GO:0015078|"GO:hydrogen ion transmembrane transporter activity"|PF00137|IPR002379| GO:PFM GO:0015986|"GO:ATP synthesis coupled proton transport"|PF00137|IPR002379| GO:PFM GO:0033177|"GO:proton-transporting two-sector ATPase complex, proton-transporting domain"|PF00137|IPR002379| RP:SCP:NREP 1 RP:SCP:REP 13->65|1ijpA|7e-10|20.8|53/79|f.17.1.1| HM:SCP:REP 1->65|1c99A_|5.6e-09|29.2|65/79|f.17.1.1|1/1|F1F0 ATP synthase subunit C| OP:NHOMO 44 OP:NHOMOORG 44 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 56 STR:RPRED 84.8 SQ:SECSTR #########GGGHHHHHHHHHHHHHHHHHHHHcGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHH# DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //