[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : axe1
DDBJ      :axe1         xylan esterase 1
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  62/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:326 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->311 1odsA PDBj 1e-35 32.7 %
:RPS:PDB   56->315 3bxpA PDBj 3e-06 8.7 %
:RPS:SCOP  7->317 1l7aA  c.69.1.25 * 4e-12 26.5 %
:HMM:SCOP  46->316 1vlqA_ c.69.1.25 * 9.3e-31 22.2 %
:RPS:PFM   16->301 PF05448 * AXE1 4e-65 47.0 %
:HMM:PFM   1->317 PF05448 * AXE1 7.9e-142 53.2 316/320  
:BLT:SWISS 7->311 CAH_BACSU 2e-34 32.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55501.1 GT:GENE axe1 GT:PRODUCT xylan esterase 1 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1548408..1549388) GB:FROM 1548408 GB:TO 1549388 GB:DIRECTION - GB:GENE axe1 GB:PRODUCT xylan esterase 1 GB:NOTE identified by match to protein family HMM PF05448 GB:PROTEIN_ID ACF55501.1 GB:DB_XREF GI:194357053 GB:GENE:GENE axe1 LENGTH 326 SQ:AASEQ MKNPALLEEIKTYRGRDEVPEDFDAFWDGEVKNVSTLPSYHLEERDFHISQVKCYELTFEGSKEGKVYARIVLPKSEEKVPLIFHFHGYMGRGWDWADMLVFTVAGYGVVSMDVRGQSGYSQDGLRSPLGNTVKGHIIRGAVEGRDHLFYKDVYLDIYQLVEIVASLSQVDEKRLSSYGASQGGALALVAAALNPRIQKTVAIYPFLSDFRRVIEIGNTSEAYDELFRYFKFHDPFHETEEEIMATLAYIDVKNLAHRIQGEVKMITGLDDDVCYPITQFAIYNRLTCDKTYRIMPEYAHEAXNVFVNDQVYNWLCGSEIPFKYLK GT:EXON 1|1-326:0| BL:SWS:NREP 1 BL:SWS:REP 7->311|CAH_BACSU|2e-34|32.3|300/318| SEG 179->193|gasqggalalvaaal| BL:PDB:NREP 1 BL:PDB:REP 7->311|1odsA|1e-35|32.7|300/316| RP:PDB:NREP 1 RP:PDB:REP 56->315|3bxpA|3e-06|8.7|230/252| RP:PFM:NREP 1 RP:PFM:REP 16->301|PF05448|4e-65|47.0|279/297|AXE1| HM:PFM:NREP 1 HM:PFM:REP 1->317|PF05448|7.9e-142|53.2|316/320|AXE1| RP:SCP:NREP 1 RP:SCP:REP 7->317|1l7aA|4e-12|26.5|306/318|c.69.1.25| HM:SCP:REP 46->316|1vlqA_|9.3e-31|22.2|266/0|c.69.1.25|1/1|alpha/beta-Hydrolases| OP:NHOMO 68 OP:NHOMOORG 63 OP:PATTERN -------------------------------------------------------------------- ----1-----------------------------------1---21--111-111-----1---1--2----------1-----------11---------------1-------------------------------11---1-------------------------------------------11---1---------------111111-----------------2----------------------------------------------111-1-1---11111111-11-------------1--------11--------------1----11---1-------11-----------1-------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------21211--- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 309 STR:RPRED 94.8 SQ:SECSTR ######HHHHTTccccccccTTHHHHHHHHcEEEEEHHHHHHHHHHHTccHHHHHEEEEccTTTccEEEEEEEEccccccEEEEEEcccTTTccccTTHHHHHHHHTEEEEEEccccTTTccccccTTTTccccccHHcTTTccccTTHHHHHHHHHHHHHHHHHHHHTEEEEEEEEEEETHHHHHHHHHHHHTTHHHHHHTTcTTccccccEEEEEcEEEEEcccccTTccccccHHHHHHHcccGGGccGGGGccTTcccEEEEEcTTcccccTHHHHHHHHHHHTcEEEEEcccccHHHHHHHHHHHHHHHH########### DISOP:02AL 1-1| PSIPRED cccHHHHHHHHcccccccccccHHHHHHHHHHHHHccccccccccccccccEEEEEEEEEcccccEEEEEEEEEccccccEEEEEEcccccccccHHHHHHHHHcccEEEEEccccccccccccccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHEEEEEEcHHHHHHHHHHHccccccEEEEEccccccHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHcccccHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHcccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHcc //