[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : carA
DDBJ      :carA         carbamoyl-phosphate synthase pyrimidine-specific small chain
Swiss-Prot:CARA_STRR6   RecName: Full=Carbamoyl-phosphate synthase small chain;         EC=6.3.5.5;AltName: Full=Carbamoyl-phosphate synthetase glutamine chain;

Homologs  Archaea  60/68 : Bacteria  825/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
c.23.16c.8.3
:359 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->358 1jdbF PDBj 3e-86 46.7 %
:RPS:PDB   1->358 1a9xB PDBj 7e-98 43.7 %
:RPS:SCOP  1->151 1a9xB1  c.8.3.1 * 3e-63 44.0 %
:RPS:SCOP  153->358 1a9xB2  c.23.16.1 * 3e-67 47.1 %
:HMM:SCOP  1->151 1a9xB1 c.8.3.1 * 2.6e-56 50.3 %
:HMM:SCOP  133->358 1a9xB2 c.23.16.1 * 7.8e-62 35.8 %
:RPS:PFM   3->127 PF00988 * CPSase_sm_chain 1e-40 60.0 %
:RPS:PFM   183->348 PF00117 * GATase 9e-24 33.7 %
:HMM:PFM   3->131 PF00988 * CPSase_sm_chain 2.1e-59 57.4 129/131  
:HMM:PFM   174->350 PF00117 * GATase 8e-49 33.3 177/192  
:BLT:SWISS 1->359 CARA_STRR6 0.0 99.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56178.1 GT:GENE carA GT:PRODUCT carbamoyl-phosphate synthase pyrimidine-specific small chain GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1146326..1147405) GB:FROM 1146326 GB:TO 1147405 GB:DIRECTION - GB:GENE carA GB:PRODUCT carbamoyl-phosphate synthase pyrimidine-specific small chain GB:NOTE identified by match to protein family HMM PF00117; match to protein family HMM PF00988; match to protein family HMM TIGR01368 GB:PROTEIN_ID ACF56178.1 GB:DB_XREF GI:194357730 GB:GENE:GENE carA LENGTH 359 SQ:AASEQ MTKRILVLEDGTVFEGKAFGADIDVTGEIVFNTGMTGYQESITDQSYNGQILTFTYPLVGNYGINRDDYESIIPTCKGVVVFEEARRASNWRNQMTLDEFLKAKKIPGISGIDTRALTKIIRKHGTMRATLTHVGDSMDHVTDQLQATVLPTDNIKQVSTKTSYPAPGVGLSVVLVDFGLKHSILRELSKRNCNVTVVPYSTTAEEILHLNPDGVXLSNGPGNPEDVPQALDMIRGVQGKIPIFGICMGHQLFAMANGAKTYKMKFGHRGFNHAVREIATGRVDFTSQNHGYAVSREDLPEHLIITHEEINDKSVEGVRHRYQPAFSVQYHPDAAPGPHDASYLFDEFIEMMEVFKQSN GT:EXON 1|1-359:0| SW:ID CARA_STRR6 SW:DE RecName: Full=Carbamoyl-phosphate synthase small chain; EC=6.3.5.5;AltName: Full=Carbamoyl-phosphate synthetase glutamine chain; SW:GN Name=carA; OrderedLocusNames=spr1154; SW:KW Amino-acid biosynthesis; Arginine biosynthesis; ATP-binding;Complete proteome; Glutamine amidotransferase; Ligase;Nucleotide-binding; Pyrimidine biosynthesis. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->359|CARA_STRR6|0.0|99.7|359/359| GO:SWS:NREP 7 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0006526|"GO:arginine biosynthetic process"|Arginine biosynthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0006541|"GO:glutamine metabolic process"|Glutamine amidotransferase| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006221|"GO:pyrimidine nucleotide biosynthetic process"|Pyrimidine biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 5->358|1jdbF|3e-86|46.7|353/380| RP:PDB:NREP 1 RP:PDB:REP 1->358|1a9xB|7e-98|43.7|357/378| RP:PFM:NREP 2 RP:PFM:REP 3->127|PF00988|1e-40|60.0|125/131|CPSase_sm_chain| RP:PFM:REP 183->348|PF00117|9e-24|33.7|166/185|GATase| HM:PFM:NREP 2 HM:PFM:REP 3->131|PF00988|2.1e-59|57.4|129/131|CPSase_sm_chain| HM:PFM:REP 174->350|PF00117|8e-49|33.3|177/192|GATase| GO:PFM:NREP 3 GO:PFM GO:0004086|"GO:carbamoyl-phosphate synthase activity"|PF00988|IPR002474| GO:PFM GO:0006807|"GO:nitrogen compound metabolic process"|PF00988|IPR002474| GO:PFM GO:0003824|"GO:catalytic activity"|PF00117|IPR000991| RP:SCP:NREP 2 RP:SCP:REP 1->151|1a9xB1|3e-63|44.0|150/151|c.8.3.1| RP:SCP:REP 153->358|1a9xB2|3e-67|47.1|206/228|c.23.16.1| HM:SCP:REP 1->151|1a9xB1|2.6e-56|50.3|151/151|c.8.3.1|1/1|Carbamoyl phosphate synthetase, small subunit N-terminal domain| HM:SCP:REP 133->358|1a9xB2|7.8e-62|35.8|226/0|c.23.16.1|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 2199 OP:NHOMOORG 1076 OP:PATTERN 11-1-11222222222-222222141121223221333222222222213332212--1-1111--21 2222312222223222211-12112111111232221332222212121111222222112211122232233333332-1122212222212222-1111111111121--------------122222222222222222221223322232222222222223123322222222222223321132123333333333333333333333333333334433332333212222222222222231113121411432223322111222311112221222222222222222221111111111111211222111135-23---111-1-1334422222-3--2223244322111322223-31224222211111233222222211122222222222-22323322222122222222222222222122222222222222222222122231111111111---------------111121211322222222222322222222222222222222222222222222221132222222222222222222222132221111121111222222222222222222112111111111111111122222222222222222221111211111221112221-1222211111122222222222222222-22222222222222222222222233222222222222222222222222221222222222222122222122222222232---1111---121-122222222222222222223222222222212122221222222112132212222222222233221121332222--------------------------------------21121222221 11--113-311-1231224233324233323332232322232222332333333333333332333323333332323333333332-22222232223222454-22143322322122222432216H2-3221122212211221222122322213-13211211611412222V2222243743722254332 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 359 STR:RPRED 100.0 SQ:SECSTR ccEEEEEETTccEEEEEEccccEEEEEEEEEEcccccHHHHHTcGGGcTEEEEEccccccTTcccGGGcccccccccEEEccccccccccTTccccHHHHHHHTTcEEEEcccHHHHHHHHHHHccEEEEEEEccccccHHHHHHHHHHccccTTHHHcccccEcGGGccEEEEEEEccccHHHHHHHHHTTEEEEEEETTccHHHHHTTcccEEEEcccccccTTcHHHHHHHHHHTTccccEEEEHHHHHHHHHTTccEEEEEEEEEEEEEEEEETTTTEEEEEEEEEEEEEccTTccTTEEEEEEETTTccEEEEEEccccEEEEcccTTccccccTTTHHHHHHHHHHHHHHHcH DISOP:02AL 1-1,357-360| PSIPRED cccEEEEEccccEEEEEEEccccEEEEEEEEEccccccccccccHHHccEEEEEcccccccccccHHHHcccccEEEEEEEccccccccccHHHccHHHHHHHccccEEccccHHHHHHHHHHcccEEEEEEEccccHHHHHHHHccccccccccHHEEccccccccccccEEEEEEcccHHHHHHHHHHcccEEEEEEccccHHHHHHccccEEEEccccccHHHcccHHHHHHHHHccccEEEEcHHHHHHHHHcccEEEEcccccccccccccccccccEEEEEEEEEEEEEEccccccEEEEEEEcccccEEEEEEccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHcc //