[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : cibB
DDBJ      :cibB         competence induced bacteriocin B
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:50 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->22 PF03047 * ComC 4.2e-07 55.0 20/32  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55072.1 GT:GENE cibB GT:PRODUCT competence induced bacteriocin B GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(132460..132612) GB:FROM 132460 GB:TO 132612 GB:DIRECTION - GB:GENE cibB GB:PRODUCT competence induced bacteriocin B GB:NOTE identified by match to protein family HMM TIGR01847 GB:PROTEIN_ID ACF55072.1 GB:DB_XREF GI:194356624 GB:GENE:GENE cibB LENGTH 50 SQ:AASEQ MMKDLNNYREISNKELQEIKGGFGVGVGIALFMAGYTIGKDLRKKFGKSC GT:EXON 1|1-50:0| TM:NTM 1 TM:REGION 18->40| HM:PFM:NREP 1 HM:PFM:REP 3->22|PF03047|4.2e-07|55.0|20/32|ComC| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,48-51| PSIPRED ccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccc //