[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : comC
DDBJ      :comC         competence-stimulating peptide type 1, CSP1
Swiss-Prot:CSP1_STRR6   RecName: Full=Competence-stimulating peptide type 1;         Short=CSP-1;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:41 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->31 PF03047 * ComC 3.2e-16 48.4 31/32  
:BLT:SWISS 1->41 CSP1_STRR6 5e-19 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56795.1 GT:GENE comC GT:PRODUCT competence-stimulating peptide type 1, CSP1 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(2075871..2075996) GB:FROM 2075871 GB:TO 2075996 GB:DIRECTION - GB:GENE comC GB:PRODUCT competence-stimulating peptide type 1, CSP1 GB:NOTE identified by match to protein family HMM PF03047 GB:PROTEIN_ID ACF56795.1 GB:DB_XREF GI:194358347 GB:GENE:GENE comC LENGTH 41 SQ:AASEQ MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK GT:EXON 1|1-41:0| SW:ID CSP1_STRR6 SW:DE RecName: Full=Competence-stimulating peptide type 1; Short=CSP-1;Flags: Precursor; SW:GN Name=comC1; Synonyms=comC; OrderedLocusNames=spr2043; SW:KW 3D-structure; Competence; Complete proteome; Pheromone; Secreted. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->41|CSP1_STRR6|5e-19|100.0|41/41| GO:SWS:NREP 3 GO:SWS GO:0030420|"GO:establishment of competence for transformation"|Competence| GO:SWS GO:0005186|"GO:pheromone activity"|Pheromone| GO:SWS GO:0005576|"GO:extracellular region"|Secreted| HM:PFM:NREP 1 HM:PFM:REP 1->31|PF03047|3.2e-16|48.4|31/32|ComC| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,41-42| PSIPRED ccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccc //