[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : comD
DDBJ      :comD         ComD histidine kinase TCS12
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  115/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.122.1
:441 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   265->439 2btzA PDBj 9e-06 11.7 %
:RPS:SCOP  292->439 2c2aA2  d.122.1.3 * 1e-04 22.0 %
:HMM:SCOP  289->438 1id0A_ d.122.1.3 * 8.6e-10 18.4 %
:HMM:PFM   337->434 PF02518 * HATPase_c 3.1e-09 28.1 96/111  
:BLT:SWISS 221->411 CITS_BACSU 7e-10 24.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56316.1 GT:GENE comD GT:PRODUCT ComD histidine kinase TCS12 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(2074525..2075850) GB:FROM 2074525 GB:TO 2075850 GB:DIRECTION - GB:GENE comD GB:PRODUCT ComD histidine kinase TCS12 GB:NOTE identified by match to protein family HMM PF02518 GB:PROTEIN_ID ACF56316.1 GB:DB_XREF GI:194357868 GB:GENE:GENE comD LENGTH 441 SQ:AASEQ MDLFGFGTVIVHFLIISHSYHFICKGQINRKELFVFGAYTLLTEIVFDFPLYILYLDGLGIERFLFPLGLYSYFRWMKQYERDRGLFLSLLLSLLYESTHNFLSVTFSSITGDNFVLQYHFPFFFVVTVLTYFVTLKIIYYFHLELAYFDEDYLYPFLKKVFFALLLLHIVSFVSDMVSTIKHLNSFGSILSSIVFISLLLTFFAMNSHKVQMEKEIALKQKKFEQKHLQNYTDEIVGLYNEIRGFRHDYAGMLVSMQMAIDSGNLQEIDRIYNEVLVKXNHKLRSDKYTYFDLNNIEDSALRSLVAQSIVYARNNGVEFTLEVKDTITKLPIELLDLVRIMSVLLNNAVEGSADSYKKQMEVAVIKMETETVVVIQNSCKMTMTPSGDLFALGFSTKGRNRGVGLNNVKELLDKYNNIILETEMEGSTFRQIIRFKREFE GT:EXON 1|1-441:0| BL:SWS:NREP 1 BL:SWS:REP 221->411|CITS_BACSU|7e-10|24.5|184/542| TM:NTM 4 TM:REGION 1->23| TM:REGION 115->137| TM:REGION 161->183| TM:REGION 187->208| SEG 86->95|lflslllsll| SEG 123->136|fffvvtvltyfvtl| SEG 157->168|flkkvffallll| SEG 186->204|sfgsilssivfisllltff| RP:PDB:NREP 1 RP:PDB:REP 265->439|2btzA|9e-06|11.7|171/357| HM:PFM:NREP 1 HM:PFM:REP 337->434|PF02518|3.1e-09|28.1|96/111|HATPase_c| RP:SCP:NREP 1 RP:SCP:REP 292->439|2c2aA2|1e-04|22.0|141/151|d.122.1.3| HM:SCP:REP 289->438|1id0A_|8.6e-10|18.4|141/146|d.122.1.3|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 189 OP:NHOMOORG 115 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22222131-22211311111-221---1---111111---111111111--11111111121---1---244--1111112-----1-33331112222222222233323333433231--111---5-32111111111-1-11--1-----1-1------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 203 STR:RPRED 46.0 SQ:SECSTR ############################################################################################################################################################################################################################################HHHHHHHHHHHHHTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccTTcEEEEEHHHHHHHHHHHHHHHHHHHHcccccEEEEETTcTTcccEEEEcHHHHHHHHHHHHHHHHHHTTTTccccccEEEEcccEEEEEEEEccccccHHHHHHHTcTTTTcccccHHHHHHHHHHHTTEEEEEEETTEEEEEEEEEEEcc## DISOP:02AL 1-1,440-442| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEccEEEEEEEccccccHHHHHHHHccccccccccccccHHHHHHHHHHcccEEEEEEccccEEEEEEEEccccc //