[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : comE
DDBJ      :comE         ComE response regulator TCS12
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  127/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.23.1
:250 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->110 2qv0A PDBj 7e-04 32.7 %
:BLT:PDB   136->240 3bs1A PDBj 1e-10 30.4 %
:RPS:PDB   1->123 3cu5B PDBj 2e-06 17.1 %
:RPS:PDB   140->240 3bs1A PDBj 9e-16 29.6 %
:RPS:SCOP  1->123 1f51E  c.23.1.1 * 1e-08 11.4 %
:HMM:SCOP  1->125 1ny5A1 c.23.1.1 * 4.2e-09 20.4 %
:RPS:PFM   153->244 PF04397 * LytTR 1e-07 37.1 %
:HMM:PFM   151->244 PF04397 * LytTR 2.8e-24 35.2 91/98  
:HMM:PFM   32->121 PF00072 * Response_reg 4.3e-10 24.1 87/112  
:BLT:SWISS 1->240 AGRA_STAES 2e-26 32.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55408.1 GT:GENE comE GT:PRODUCT ComE response regulator TCS12 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(2073776..2074528) GB:FROM 2073776 GB:TO 2074528 GB:DIRECTION - GB:GENE comE GB:PRODUCT ComE response regulator TCS12 GB:NOTE identified by match to protein family HMM PF00072; match to protein family HMM PF04397 GB:PROTEIN_ID ACF55408.1 GB:DB_XREF GI:194356960 GB:GENE:GENE comE LENGTH 250 SQ:AASEQ MKVLILEDVIEHQVRLERILDEISKESNIPISYKTTGKVREFEEYIENDEVNQLYFLDIDIHGIEKKGFEVAQLIRHYNPYAIIVFITSRSEFATLTYKYQVSALDFVDKDINDEMFKKRIEQNIFYTKSMLLENEDVVDYFDYNYKGNDLKIPYHDILYIETTGVSHKLRIIGKNFAKEFYGTMTDIQEKDKHTQRFYSPHKSFLVNIGNIREIDRKNLEIVFYEDHRCPISRLKIRKLKDILEKKSQK GT:EXON 1|1-250:0| BL:SWS:NREP 1 BL:SWS:REP 1->240|AGRA_STAES|2e-26|32.9|225/238| BL:PDB:NREP 2 BL:PDB:REP 1->110|2qv0A|7e-04|32.7|101/122| BL:PDB:REP 136->240|3bs1A|1e-10|30.4|102/103| RP:PDB:NREP 2 RP:PDB:REP 1->123|3cu5B|2e-06|17.1|117/129| RP:PDB:REP 140->240|3bs1A|9e-16|29.6|98/103| RP:PFM:NREP 1 RP:PFM:REP 153->244|PF04397|1e-07|37.1|89/97|LytTR| HM:PFM:NREP 2 HM:PFM:REP 151->244|PF04397|2.8e-24|35.2|91/98|LytTR| HM:PFM:REP 32->121|PF00072|4.3e-10|24.1|87/112|Response_reg| RP:SCP:NREP 1 RP:SCP:REP 1->123|1f51E|1e-08|11.4|114/119|c.23.1.1| HM:SCP:REP 1->125|1ny5A1|4.2e-09|20.4|113/0|c.23.1.1|1/1|CheY-like| OP:NHOMO 197 OP:NHOMOORG 127 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------1---------11--------------------------------------------------------------------------------------------22222122-222111-----122----1---111111---11111111111111111111211111---245--1111112----1112333211222222222221211111121111111222---2-21313333433-3-23--1111-1----1----1----11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 244 STR:RPRED 97.6 SQ:SECSTR EEEEEEcccHHHHHHHHHTcHHHccEcTTTccEEEEEEEccHHHHHHHHHHccccEEEEEcccTTccHHHHHHHHHHHcTTcEEEEEEcTTcHHHHHHHccccccEEEEccccTTHHHHHHHHHHccccEEcTTTcccccEEEEEETTEEEEEEGGGEEEEEEcccTTEEEEEEcccEEEEEccHHHHHHHccTcTTEEEEETTEEEEGGGEEEEETTTTEEEETTccEEEccTTTGGGcHHHH###### DISOP:02AL 248-251| PSIPRED cEEEEEcccHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHcccccEEEEEEEcccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccEEEEEccccEEEEEEccccEEEEEEEEccEEEEcccHHHHHHHccccccEEEEEHHHEEEHHHHHHEccccEEEEEEcccEEEEEHHHHHHHHHHHHHcccc //