[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : cvpA
DDBJ      :cvpA         CvpA family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  64/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:182 amino acids
:PSIPRED
:HMM:PFM   2->165 PF02674 * Colicin_V 3.3e-32 29.7 145/146  
:BLT:SWISS 19->176 YSHB_BACSU 1e-07 22.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55564.1 GT:GENE cvpA GT:PRODUCT CvpA family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 364153..364701 GB:FROM 364153 GB:TO 364701 GB:DIRECTION + GB:GENE cvpA GB:PRODUCT CvpA family protein GB:NOTE identified by match to protein family HMM PF02674 GB:PROTEIN_ID ACF55564.1 GB:DB_XREF GI:194357116 GB:GENE:GENE cvpA LENGTH 182 SQ:AASEQ MISFLLLLVLVWGFYIGYRRGLLLQVYYLISAMASAFMAGQFYKGLGEQFHLLLPYANSQEDQGTFFFPSDQLFQLDKVFYAGIGYLLVFGIVYSIGRLLGLLLHLIPSQKLGGKLFQVSAGILSMLVTLFVLQMALTILATIPMAVIQNPLEKSIVAKHIIQSIPITTSWLKQIWVTNLIG GT:EXON 1|1-182:0| BL:SWS:NREP 1 BL:SWS:REP 19->176|YSHB_BACSU|1e-07|22.1|154/100| TM:NTM 5 TM:REGION 1->18| TM:REGION 26->48| TM:REGION 84->106| TM:REGION 121->143| TM:REGION 161->182| SEG 99->106|llglllhl| HM:PFM:NREP 1 HM:PFM:REP 2->165|PF02674|3.3e-32|29.7|145/146|Colicin_V| OP:NHOMO 64 OP:NHOMOORG 64 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------1-------1-11--11-----1--1---------------11--1-------1-1----111-----11111111111111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcc //