[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : dltA
DDBJ      :dltA         D-alanine--poly(phosphoribitol) ligase subunit 1
Swiss-Prot:DLTA_STRZT   RecName: Full=D-alanine--poly(phosphoribitol) ligase subunit 1;         EC=6.1.1.13;AltName: Full=D-alanine-activating enzyme;         Short=DAE;AltName: Full=D-alanine-D-alanyl carrier protein ligase;         Short=DCL;

Homologs  Archaea  46/68 : Bacteria  725/915 : Eukaryota  174/199 : Viruses  0/175   --->[See Alignment]
e.23.1
:516 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->513 3fceA PDBj e-110 42.7 %
:RPS:PDB   9->509 3e7wA PDBj 7e-61 37.7 %
:RPS:SCOP  2->516 1md9A  e.23.1.1 * 2e-59 19.9 %
:HMM:SCOP  8->516 1pg4A_ e.23.1.1 * 8.3e-119 28.3 %
:RPS:PFM   34->425 PF00501 * AMP-binding 2e-31 30.3 %
:RPS:PFM   449->516 PF09897 * DUF2124 7e-04 35.3 %
:HMM:PFM   34->435 PF00501 * AMP-binding 1.4e-91 31.6 396/418  
:BLT:SWISS 1->516 DLTA_STRZT 0.0 99.8 %
:PROS 153->164|PS00455|AMP_BINDING

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56686.1 GT:GENE dltA GT:PRODUCT D-alanine--poly(phosphoribitol) ligase subunit 1 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(2009778..2011328) GB:FROM 2009778 GB:TO 2011328 GB:DIRECTION - GB:GENE dltA GB:PRODUCT D-alanine--poly(phosphoribitol) ligase subunit 1 GB:NOTE identified by match to protein family HMM PF00501; match to protein family HMM TIGR01733; match to protein family HMM TIGR01734 GB:PROTEIN_ID ACF56686.1 GB:DB_XREF GI:194358238 GB:GENE:GENE dltA LENGTH 516 SQ:AASEQ MSNKPIADMIETIEHFAQTQPSYPVYNVLGQEHTYGDLKADSDSLAAVIDQLGLPEKSPVVVFGGQEYEMLATFVALTKSGHAYIPIDSHSALERVSAILEVAEPSLIIAISAFPLEQVSTPMINLAQVQEAFAQGNNYEITHPVKGDDNYYIIFTSGTTGKPKGVQISHDNLLSFTNWMITDKEFATPSRPQMLAQPPYSFDLSVMYWAPTLALGGTLFTLPSVITQDFKQLFAAIFSLPIAIWTSTPSFADMAMLSEYFNSEKMSGITHFYFDGEELTVKTAQKLRERFPNARIINAYGPTEATVALSAVAVTDEMLATLKRLPIGYTKADSPTFIIDEEGNKLPNGEQGEIIVSGPAVSKGYMKNPEKTAEAFFEFEGLPAYHTGDVGTMTDEGLLLYGGRMDFQIKFNGYRIELEDVSQNLNKSRFIESAVAVPRYNKDHKVQNLLAYVILKDGVREQFERDIDITKAIKEDLTDIMMSYMMPSKFLYRDSLPLTPNGKIDIKGLINEVNKR GT:EXON 1|1-516:0| SW:ID DLTA_STRZT SW:DE RecName: Full=D-alanine--poly(phosphoribitol) ligase subunit 1; EC=6.1.1.13;AltName: Full=D-alanine-activating enzyme; Short=DAE;AltName: Full=D-alanine-D-alanyl carrier protein ligase; Short=DCL; SW:GN Name=dltA; OrderedLocusNames=SPT_2191; SW:KW ATP-binding; Complete proteome; Cytoplasm; Ligase; Nucleotide-binding. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->516|DLTA_STRZT|0.0|99.8|516/516| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| PROS 153->164|PS00455|AMP_BINDING|PDOC00427| BL:PDB:NREP 1 BL:PDB:REP 9->513|3fceA|e-110|42.7|494/500| RP:PDB:NREP 1 RP:PDB:REP 9->509|3e7wA|7e-61|37.7|494/508| RP:PFM:NREP 2 RP:PFM:REP 34->425|PF00501|2e-31|30.3|376/405|AMP-binding| RP:PFM:REP 449->516|PF09897|7e-04|35.3|68/147|DUF2124| HM:PFM:NREP 1 HM:PFM:REP 34->435|PF00501|1.4e-91|31.6|396/418|AMP-binding| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00501|IPR000873| GO:PFM GO:0008152|"GO:metabolic process"|PF00501|IPR000873| RP:SCP:NREP 1 RP:SCP:REP 2->516|1md9A|2e-59|19.9|493/536|e.23.1.1| HM:SCP:REP 8->516|1pg4A_|8.3e-119|28.3|498/643|e.23.1.1|1/1|Acetyl-CoA synthetase-like| OP:NHOMO 6283 OP:NHOMOORG 945 OP:PATTERN 11----3788A88784--4221-B411121233211--222214274741433--------12----- 2241R653334837KSHBB-BF55WJBBBBBEIIMIOgvs1G892--1132-647427--KI82SDLOES51---122-374A-14215521-2--1--1-A---G-2-21------11111111211121--2-233389---X378C-BBD1------1------H9R3---11--1-1--42322--3A7P99A9AF7DAABBEF967EEEI9AG8FBD933222222U52444444544444443333421111111121131111121121111111212115412211111111111111111211111112211121---62222622122J299------41-5216-A75241--731111-1-4123228-----57CBN225GKIDC22332232233-665767666C6-977B55444785AC23154B2233835--------51--2543----------111-11-11111111-----3AL7-4BE79BDEDFILGJJEAABGVVVUCQI9KJMUH1-66927C77K47AKF1-3---18122222221248551XC64446654333-3442312544424VB7622221222212-2-------12125--451324514322333396433335353366--11412------C4I9431555B5CC754-4575567577577555554547AAQT3534455555564544674545554--476767544464---324242556436R2A111121-111-1111777972533594FHDGOGGF5CBDA5GHN3233331321122A455554213322423221111111-------------1-11-21------------------------------------271 ----951-----668JJNDRKWPcbXdEECCCCQSOHEEEDGFDCDKCIbPPMOFCNIA8673-11121122111121222111-133-7E6J9963333339BAA-273B-9133721-1151D4-21BR7-68612215-142233--82-D163388466M4B3K8BC8ACD----A41231D89TRGE3396827 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 515 STR:RPRED 99.8 SQ:SECSTR #TcccHHHHHHHHHHHHHHcTTcEEEEETTEEEEHHHHHHHHHHHHHHHTTccccccccEEEEEcccHHHHHHHHHHHHHTccEEEEETTccHHHHHHHHHHHTccEEEEcccccTTcccccccEEEHHHHHTcccccccGGGcccTTcEEEEEEEccTTcccEEEEEEHHHHHHHHHHHHHHcTTTTTcEcEEEEcccTTcTHHHHHHHHHHHTTcEEEEccHHHHHcHHHHHHHHHHHcccEEEEcHHHHHHHHTcTTccTTTcTTccEEEEccccccHHHHHHHHHHcTTcEEEEccccGGGccccEEEEEcHHHHTTcccccccEEcTTcEEEEEcTTcccccTTccEEEEEEcTTcccccTTcHHHHHHHEEEEccccEEEEEEEEEEEETTEEEEEEEcccEEEETTEEEEHHHHHHHHHHcTTEEEEEEEEEEcccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHccGGGcccEEEEcccccccTTccccHHHHHHHHccc DISOP:02AL 1-2,513-517| PSIPRED ccccccccHHHHHHHHHHHccccEEEEEcccEEEHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHHcEEEEEccccccHHHHHHHHHHccccEEEEccccccccccccEEEEccHHHHcccccccccccccccccEEEEEEcccccccccEEEEcHHHHHHHHHHHHHHcccccccccEEEEcccHHHHHHHHHHHHHHHHccEEEEccHHccccHHHHHHHHHHHcccEEEcHHHHHHHHHHccccccccccccEEEEEccccccHHHHHHHHHHccccEEEEcccccHHHHEEEEEEcccccccccccccccEEccccEEEEEccccccccccccEEEEEccccccccccccHHHHHHHHcccccccccEEccEEEEccccEEEEEEEcccEEEEccEEEcHHHHHHHHHHcccHHEEEEEEEEcccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEccccccccccccHHHHHHHHHcc //