[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : dltC
DDBJ      :dltC         D-alanine--poly(phosphoribitol) ligase subunit 2
Swiss-Prot:DLTC_STRZT   RecName: Full=D-alanine--poly(phosphoribitol) ligase subunit 2;         EC=6.1.1.13;AltName: Full=D-alanyl carrier protein;         Short=DCP;

Homologs  Archaea  0/68 : Bacteria  119/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.28.1
:79 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->77 1dv5A PDBj 3e-16 45.3 %
:RPS:PDB   2->78 2amwA PDBj 2e-07 16.9 %
:RPS:SCOP  3->77 1dv5A  a.28.1.3 * 1e-20 45.3 %
:HMM:SCOP  1->77 1dv5A_ a.28.1.3 * 6.4e-12 31.2 %
:HMM:PFM   8->71 PF00550 * PP-binding 2e-11 35.0 60/67  
:BLT:SWISS 1->79 DLTC_STRZT 4e-41 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55448.1 GT:GENE dltC GT:PRODUCT D-alanine--poly(phosphoribitol) ligase subunit 2 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(2008284..2008523) GB:FROM 2008284 GB:TO 2008523 GB:DIRECTION - GB:GENE dltC GB:PRODUCT D-alanine--poly(phosphoribitol) ligase subunit 2 GB:NOTE identified by match to protein family HMM TIGR01688 GB:PROTEIN_ID ACF55448.1 GB:DB_XREF GI:194357000 GB:GENE:GENE dltC LENGTH 79 SQ:AASEQ MDIKSEVIEIIDELFMEDVSDMMDEDLFDAGVLDSMGTVELIVEIENRFDIRVPVTEFGRDDWNTANKIIAGIVELQNA GT:EXON 1|1-79:0| SW:ID DLTC_STRZT SW:DE RecName: Full=D-alanine--poly(phosphoribitol) ligase subunit 2; EC=6.1.1.13;AltName: Full=D-alanyl carrier protein; Short=DCP; SW:GN Name=dltC; OrderedLocusNames=SPT_2189; SW:KW ATP-binding; Cell shape; Cell wall biogenesis/degradation;Complete proteome; Ligase; Nucleotide-binding; Phosphopantetheine. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->79|DLTC_STRZT|4e-41|100.0|79/79| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0008360|"GO:regulation of cell shape"|Cell shape| GO:SWS GO:0007047|"GO:cellular cell wall organization"|Cell wall biogenesis/degradation| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| BL:PDB:NREP 1 BL:PDB:REP 3->77|1dv5A|3e-16|45.3|75/80| RP:PDB:NREP 1 RP:PDB:REP 2->78|2amwA|2e-07|16.9|77/83| HM:PFM:NREP 1 HM:PFM:REP 8->71|PF00550|2e-11|35.0|60/67|PP-binding| RP:SCP:NREP 1 RP:SCP:REP 3->77|1dv5A|1e-20|45.3|75/80|a.28.1.3| HM:SCP:REP 1->77|1dv5A_|6.4e-12|31.2|77/80|a.28.1.3|1/1|ACP-like| OP:NHOMO 122 OP:NHOMOORG 119 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------1111111121111111--1111111---1---111111---1111111111111111111111111111112211111-111111111111111111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 98.7 SQ:SECSTR #HHHHHHHHHTTcGGGGGcccTTcccTTTcTTTTHHHHHHHHHHHHHHTTccccTTTccGGGcccHHHHHHHHHHHHcc DISOP:02AL 1-1,78-80| PSIPRED ccHHHHHHHHHHHHHHHHHHHHccHHHHHHccHHHHHHHHHHHHHHHHHcccccccHHcHHHHHHHHHHHHHHHHHHcc //