[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : dpnA
DDBJ      :dpnA         DNA adenine methyltransferase DpnII
Swiss-Prot:MTD22_STRPN  RecName: Full=Modification methylase DpnIIB;         Short=M.DpnIIB;         EC=2.1.1.72;AltName: Full=Adenine-specific methyltransferase DpnIIB;AltName: Full=M.DpnII 2;

Homologs  Archaea  13/68 : Bacteria  373/915 : Eukaryota  1/199 : Viruses  14/175   --->[See Alignment]
c.66.1
:256 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->245 1g60B PDBj 5e-28 38.8 %
:RPS:PDB   1->256 1booA PDBj 5e-25 19.1 %
:RPS:SCOP  13->250 1g60A  c.66.1.11 * 4e-56 35.2 %
:HMM:SCOP  7->252 1eg2A_ c.66.1.11 * 1.5e-66 38.6 %
:RPS:PFM   30->243 PF01555 * N6_N4_Mtase 3e-28 43.3 %
:HMM:PFM   31->246 PF01555 * N6_N4_Mtase 7.6e-60 41.0 205/231  
:HMM:PFM   5->54 PF09445 * Methyltransf_15 4.9e-05 37.0 46/164  
:BLT:SWISS 1->256 MTD22_STRPN e-153 100.0 %
:PROS 33->39|PS00092|N6_MTASE

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56540.1 GT:GENE dpnA GT:PRODUCT DNA adenine methyltransferase DpnII GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1671721..1672491) GB:FROM 1671721 GB:TO 1672491 GB:DIRECTION - GB:GENE dpnA GB:PRODUCT DNA adenine methyltransferase DpnII GB:NOTE Lacks,S.; J. Mol. Biol. 250 (2), 144-155 (1995); identified by match to protein family HMM PF01555 GB:PROTEIN_ID ACF56540.1 GB:DB_XREF GI:194358092 GB:GENE:GENE dpnA LENGTH 256 SQ:AASEQ MTKPYYNKNKMILVHSDTFKFLSKMKPESMDMIFADPPYFLSNGGISNSGGQVVSVDKGDWDKISSFEEKHEFNRKWIRLAKEVLKPNGTVWISGSLHNIYSVGMALEQEGFKILNNITWQKTNPAPNLSCRYFTHSTETILWARKNDKKARHYYNYDLMKELNDGKQMKDVWTGSLTKKVEKWAGKHPTQKPEYLLERIILASTKEGDYILDPFVGSGTTGVVAKRLGRRFIGIDAEKEYLKIARKRLEAENETN GT:EXON 1|1-256:0| SW:ID MTD22_STRPN SW:DE RecName: Full=Modification methylase DpnIIB; Short=M.DpnIIB; EC=2.1.1.72;AltName: Full=Adenine-specific methyltransferase DpnIIB;AltName: Full=M.DpnII 2; SW:GN Name=dpnA; SW:KW Alternative initiation; Direct protein sequencing; Methyltransferase;Restriction system; S-adenosyl-L-methionine; Transferase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->256|MTD22_STRPN|e-153|100.0|256/268| GO:SWS:NREP 3 GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0009307|"GO:DNA restriction-modification system"|Restriction system| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 33->39|PS00092|N6_MTASE|PDOC00087| BL:PDB:NREP 1 BL:PDB:REP 19->245|1g60B|5e-28|38.8|206/228| RP:PDB:NREP 1 RP:PDB:REP 1->256|1booA|5e-25|19.1|241/282| RP:PFM:NREP 1 RP:PFM:REP 30->243|PF01555|3e-28|43.3|194/218|N6_N4_Mtase| HM:PFM:NREP 2 HM:PFM:REP 31->246|PF01555|7.6e-60|41.0|205/231|N6_N4_Mtase| HM:PFM:REP 5->54|PF09445|4.9e-05|37.0|46/164|Methyltransf_15| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF01555|IPR002941| GO:PFM GO:0006306|"GO:DNA methylation"|PF01555|IPR002941| GO:PFM GO:0008170|"GO:N-methyltransferase activity"|PF01555|IPR002941| RP:SCP:NREP 1 RP:SCP:REP 13->250|1g60A|4e-56|35.2|219/239|c.66.1.11| HM:SCP:REP 7->252|1eg2A_|1.5e-66|38.6|223/279|c.66.1.11|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 598 OP:NHOMOORG 401 OP:PATTERN ----------------------------1--------1--11-22-11-------------123--81 --1--1-1---2------------------------11----1-------111211-111--------2-----------1-1--11-11---2------1----1---------------------1223--13-43375-1-3-1341-15------------2--12------------------112-2----------------1------------------------------------------11------------11--1--1------1---2--1111112221112----11---11--1--11------------------1--------------21-11---24111-----2--1-31111112112111113111211111111111111-1212111112111121222111212311111511221111111111112411211-------------------------2-24112321---1-1122217111122111212-21311111--11111--1-----121-1-----12--1-1-2-------1---111-121--1--1----2211121---1-1-2--2-6-76655441----11-1------1-1-1----------------1-------------1----1-1221131231-41121321223211111112-----11111-1111111111-1-25-1112---111-1111-------------1--1-----------1--11-1--1--------11---2------------------------1-111111-1---1-111---112212---1----------------2------1--1-------1-------11--111111--- ------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------ ----------1-1--1------1111------------------1------1-------------------------------------------------------------------1---------------1----------11--1------------------------ STR:NPRED 256 STR:RPRED 100.0 SQ:SECSTR cccccEEcccEEEEEccHHHHGGGcccccEEEEEEcccccccGGGGTcccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEccHHHHHHHHHHHTTccEEEEEEEEEccccTTccTcccccTccccEEEEccccccccGGGccccccccEEEcccccccHHHHHHHHHTTcccccccccTHHHHHHHHHHccTTcEEEETTcTTcHHHHHHHHTTcEEEEEEccHHHHHHHHGGGccccccH DISOP:02AL 1-1,252-257| PSIPRED ccccccccccEEEEEccHHHHHHHcccccEEEEEEccccccccccccccccEEcccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHcccEEEEEEEEEccccccccccccccccccEEEEEEccccccccccccHHHccccccccccEEEccccccccccccccccccccHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHccEEEEEEccHHHHHHHHHHHHHHcccc //