[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : dpnB
DDBJ      :dpnB         DpnII endonuclease
Swiss-Prot:T2D2_STRPN   RecName: Full=Type-2 restriction enzyme DpnII;         Short=R.DpnII;         EC=3.1.21.4;AltName: Full=Type II restriction enzyme DpnII;AltName: Full=Endonuclease DpnII;

Homologs  Archaea  2/68 : Bacteria  26/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:288 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   76->229 2nubA PDBj 4e-04 27.7 %
:RPS:PFM   5->287 PF04556 * DpnII 5e-78 59.5 %
:HMM:PFM   6->287 PF04556 * DpnII 6.6e-107 48.2 278/286  
:BLT:SWISS 1->288 T2D2_STRPN e-167 99.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55868.1 GT:GENE dpnB GT:PRODUCT DpnII endonuclease GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1670868..1671734) GB:FROM 1670868 GB:TO 1671734 GB:DIRECTION - GB:GENE dpnB GB:PRODUCT DpnII endonuclease GB:NOTE Lacks,S.; J. Mol. Biol. 250 (2), 144-155 (1995); identified by match to protein family HMM PF04556 GB:PROTEIN_ID ACF55868.1 GB:DB_XREF GI:194357420 GB:GENE:GENE dpnB LENGTH 288 SQ:AASEQ MKQTRNFDEWLSTMTDTVADWTYYTDFPKVYKNVSSIKVALNIMNSLIGSKNIQEDFLDLYQNYPEILKVVPLLIAKRLRDTIIVKDPIKDFYFDFSKRNYSIEEYTMFLEKSGIFDLLQNHLVSNLVDYVTGVEVGMDTNGRKNRTGDAMENIVQSYLEAEGYILGENLFKEIEQNEIEEIFSVDLSAITNDGNTVKRFDFVIKNEQVLYLIEVNFYSGSGSKLNETARSYKMIAEEIKAIPNVEFMWITDGQGWYKAKNNLRETFDILPFLYNINDLEHNILKNLK GT:EXON 1|1-288:0| SW:ID T2D2_STRPN SW:DE RecName: Full=Type-2 restriction enzyme DpnII; Short=R.DpnII; EC=3.1.21.4;AltName: Full=Type II restriction enzyme DpnII;AltName: Full=Endonuclease DpnII; SW:GN Name=dpnB; SW:KW Direct protein sequencing; Endonuclease; Hydrolase; Nuclease;Restriction system. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->288|T2D2_STRPN|e-167|99.7|288/288| GO:SWS:NREP 4 GO:SWS GO:0004519|"GO:endonuclease activity"|Endonuclease| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0004518|"GO:nuclease activity"|Nuclease| GO:SWS GO:0009307|"GO:DNA restriction-modification system"|Restriction system| BL:PDB:NREP 1 BL:PDB:REP 76->229|2nubA|4e-04|27.7|141/690| RP:PFM:NREP 1 RP:PFM:REP 5->287|PF04556|5e-78|59.5|279/283|DpnII| HM:PFM:NREP 1 HM:PFM:REP 6->287|PF04556|6.6e-107|48.2|278/286|DpnII| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF04556|IPR007637| GO:PFM GO:0009036|"GO:Type II site-specific deoxyribonuclease activity"|PF04556|IPR007637| GO:PFM GO:0009307|"GO:DNA restriction-modification system"|PF04556|IPR007637| OP:NHOMO 29 OP:NHOMOORG 29 OP:PATTERN ---------------------------------1--1------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------11----111---1-------------1----------------------------------1---1-----------1-11--1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1-1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1---1--1111------------1-------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 49.0 SQ:SECSTR ###########################################################################HHHHTTTTTTTcccccEEEEEEccccccccccccc####HHHHHHHHHHHTTccE####EEEEHHHHHHccHHHHHHHHHHHHHHHTTccccE##Ecccc#ccccEEEEEEEEEEcccccccEEEEEETTccEEEEEE##EEcccccccHHHHH########################################################### DISOP:02AL 1-3| PSIPRED ccccccHHHHHHHHHHHcccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccccEEcccccccccccccccccHHHHHHHHHHccHHHHHHccccccHHHEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccEEEEEEEEEcccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHcccccccHHHHHHcHHHHcc //