[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : dpnM
DDBJ      :dpnM         DNA adenine methyltransferase DpnII
Swiss-Prot:MTD21_STRPN  RecName: Full=Modification methylase DpnIIA;         Short=M.DpnIIA;         EC=2.1.1.72;AltName: Full=Adenine-specific methyltransferase DpnIIA;AltName: Full=M.DpnII 1;

Homologs  Archaea  16/68 : Bacteria  301/915 : Eukaryota  1/199 : Viruses  7/175   --->[See Alignment]
c.66.1
:284 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->284 2dpmA PDBj e-146 99.6 %
:RPS:PDB   10->284 2dpmA PDBj 6e-29 98.8 %
:RPS:SCOP  10->284 2dpmA  c.66.1.28 * e-101 99.2 %
:HMM:SCOP  10->284 2dpmA_ c.66.1.28 * 2.3e-85 41.5 %
:RPS:PFM   17->253 PF02086 * MethyltransfD12 1e-52 50.2 %
:HMM:PFM   17->263 PF02086 * MethyltransfD12 7.8e-82 45.1 244/260  
:BLT:SWISS 1->284 MTD21_STRPN e-164 99.6 %
:PROS 191->197|PS00092|N6_MTASE

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54854.1 GT:GENE dpnM GT:PRODUCT DNA adenine methyltransferase DpnII GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1672517..1673371) GB:FROM 1672517 GB:TO 1673371 GB:DIRECTION - GB:GENE dpnM GB:PRODUCT DNA adenine methyltransferase DpnII GB:NOTE Lacks,S.; J. Mol. Biol. 250 (2), 144-155 (1995); identified by match to protein family HMM PF02086; match to protein family HMM TIGR00571 GB:PROTEIN_ID ACF54854.1 GB:DB_XREF GI:194356406 GB:GENE:GENE dpnM LENGTH 284 SQ:AASEQ MKIKEIKKVTLQPFTKWTGGKRQLLPVIRELMPKTYNRYFEPFVGGGALFFDLAPKDAVINDFNAELINCYQQIKDNPQELIEILKVHQEYNSKEYYLDLRSADRDERIDMMSEVQRAARILYMLRVNFNGLYRVNSKNQFNVPYGRYKNPKIVDEELISAISVYINNNQLEIKVGDFEKAIVDVRTGDFVYFDPPYIPLSETSAFTSYTHEGFSFADQVRLRDAFKRLSDTGAYVMLSNSSSALVEELYKDFNIHYVEATRTNGAKSSSRGKISEIIVTNYEK GT:EXON 1|1-284:0| SW:ID MTD21_STRPN SW:DE RecName: Full=Modification methylase DpnIIA; Short=M.DpnIIA; EC=2.1.1.72;AltName: Full=Adenine-specific methyltransferase DpnIIA;AltName: Full=M.DpnII 1; SW:GN Name=dpnM; SW:KW 3D-structure; Direct protein sequencing; Methyltransferase;Restriction system; S-adenosyl-L-methionine; Transferase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->284|MTD21_STRPN|e-164|99.6|284/284| GO:SWS:NREP 3 GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0009307|"GO:DNA restriction-modification system"|Restriction system| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 191->197|PS00092|N6_MTASE|PDOC00087| BL:PDB:NREP 1 BL:PDB:REP 10->284|2dpmA|e-146|99.6|258/258| RP:PDB:NREP 1 RP:PDB:REP 10->284|2dpmA|6e-29|98.8|258/258| RP:PFM:NREP 1 RP:PFM:REP 17->253|PF02086|1e-52|50.2|231/241|MethyltransfD12| HM:PFM:NREP 1 HM:PFM:REP 17->263|PF02086|7.8e-82|45.1|244/260|MethyltransfD12| GO:PFM:NREP 2 GO:PFM GO:0006306|"GO:DNA methylation"|PF02086|IPR012327| GO:PFM GO:0009007|"GO:site-specific DNA-methyltransferase (adenine-specific) activity"|PF02086|IPR012327| RP:SCP:NREP 1 RP:SCP:REP 10->284|2dpmA|e-101|99.2|258/259|c.66.1.28| HM:SCP:REP 10->284|2dpmA_|2.3e-85|41.5|275/0|c.66.1.28|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 481 OP:NHOMOORG 325 OP:PATTERN ------------------------------2--1--1-1111-11-21--------1-----11--31 -2---1---------------------------------------------------------------------------11---11-------1----1------------------------1--------1-11132---1-13213361111------12212231--------------------31---------1-----1-1--------111---1--1--1-1---------------------1------1-------1-------------11-11----111---1-------------1---------21-1-----1-----2143---1-12---1-2-412-2-1-1211-11-1--------4--6---------------------------------------------------------4-14-1---------------------------BH2-11-111----------------1--------13------1--1--12------1-------1----31---2--1--13----1-2-------1-1----------1---11---------1--1-----1-----1--211---1-1---1111--111111122111111111211111--11---------11212111112111212-1211123111122111211111222222113312222252431121111117-111121111124--11-----1121---2-111111111-11111--1-------------------1---13-----------11111111111111----------1-----1---11-----1-111-11114---2-1-1--1111-2----------1-------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- -----------------------------1-------1-1----------------------------------------------------------1---------------------------------------------------1-1------------------1--- STR:NPRED 262 STR:RPRED 92.3 SQ:SECSTR #########ccccccccTTccGGGHHHHHHHcccccccEEETTcTTcHHHHHHcccEEEEEEccHHHHHHHHHHHHcHHHHHHHHHHHHHHccHHHHHHHHGGGGccHHHHccHHHHHHHHHHHHHHcGGGcccccTTcccccccccccccccccHHHHHHHHHHHHHcEEEEEEccGGGGGTTccTTcEEEEcccccccccc##ccccccccccHHHHHHHHHHHHHHHTTTcEEEEEEEccHHHHHHTTTcEEEEEcc###########ccccEEEEEcccc DISOP:02AL 1-7,263-275| PSIPRED ccccccccccccccccccccHHHHHHHHHHHccccccEEEcccccHHHHHHHccccEEEEEcccHHHHHHHHHHHHcHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccEEEccccccccccccccccccccHHHHHHHHHHHHcccEEEEEccHHHHHHHcccccEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHcccEEEEEEEEEEEEccccccccccEEEEEEccc //