[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : dprA
DDBJ      :dprA         DNA processing Smf protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  815/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.129.1
:282 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   3->282 3bq9A PDBj 5e-29 12.2 %
:RPS:SCOP  81->281 1wekA  c.129.1.1 * 2e-41 17.1 %
:HMM:SCOP  74->282 1wekA_ c.129.1.1 * 1.5e-38 36.0 %
:RPS:PFM   81->271 PF02481 * DNA_processg_A 5e-59 58.1 %
:HMM:PFM   75->272 PF02481 * DNA_processg_A 4.1e-78 55.6 198/212  
:BLT:SWISS 81->279 SMF_BACSU 1e-45 46.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56253.1 GT:GENE dprA GT:PRODUCT DNA processing Smf protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1133991..1134839) GB:FROM 1133991 GB:TO 1134839 GB:DIRECTION - GB:GENE dprA GB:PRODUCT DNA processing Smf protein GB:NOTE DNA processing chain A: Also known as smf protein (name of uncharacterized protein in E. coli); identified by match to protein family HMM PF02481; match to protein family HMM TIGR00732 GB:PROTEIN_ID ACF56253.1 GB:DB_XREF GI:194357805 GB:GENE:GENE dprA LENGTH 282 SQ:AASEQ MKITNYEIYKLKKSGLTNQQILKVLEYGENVDQELLLGDIADISGCRNPAVFMERYFQIDDAHLSKEFQKFPSFSILDDCYPWDLSEIYDAPVLLFYKGNLDLLKFPKVAVVGSRACSKQGAKSVEKVIQGLENELVIVSGLAKGIDTAAHMAALQNGGKTIAVIGTGLDVFYPKANKRLQDYIGNDHLVLSEYGPGEQPLKFHFPARNRIIAGLCRGVIVAEAKMRSGSLITCERAMEEGRDVFAIPGSILDGLSDGCHHLIQEGAKLVTSGQDVLAEFEF GT:EXON 1|1-282:0| BL:SWS:NREP 1 BL:SWS:REP 81->279|SMF_BACSU|1e-45|46.2|199/297| RP:PDB:NREP 1 RP:PDB:REP 3->282|3bq9A|5e-29|12.2|270/446| RP:PFM:NREP 1 RP:PFM:REP 81->271|PF02481|5e-59|58.1|191/209|DNA_processg_A| HM:PFM:NREP 1 HM:PFM:REP 75->272|PF02481|4.1e-78|55.6|198/212|DNA_processg_A| GO:PFM:NREP 1 GO:PFM GO:0009294|"GO:DNA mediated transformation"|PF02481|IPR003488| RP:SCP:NREP 1 RP:SCP:REP 81->281|1wekA|2e-41|17.1|181/208|c.129.1.1| HM:SCP:REP 74->282|1wekA_|1.5e-38|36.0|189/0|c.129.1.1|1/1|MoCo carrier protein-like| OP:NHOMO 867 OP:NHOMOORG 821 OP:PATTERN --------------------------------1---------1---1--------1------------ 111-111111111111111-11--1-111111111111111111111111211111111111211111121111121111121111111112-1111--11111111111--------------11111111111111111111111111211111111111111111112-1-----1---111111111111--1-111111121211111111111111111111111111111111111--111-111111111111111111111111111-111111111112111111111111111111111111131111111112111111111112111111111111111111122411111111111121111111111111111111211111111111111112-11111111111-1111111111111111111212111112222222211111111111111111111--11--1------1-11-131111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111-11111111111111111111111-11111111211111111111111111111111111--11111------12111111111111211-11111211-11111111111111111111-111111111111111111111--111111111111---11111121111121111111111111111111111-111111111111111111111111----11--11111111111111111111111111111--11111111111111-111-----------1--111----11---2111211111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 280 STR:RPRED 99.3 SQ:SECSTR ##ccHHHHHHHTcGGHHHHHHHHHHTccTTcEEEEEEETTEEEEEEEcccGGGEETTEEcHHHHHHHHHHHHHHHHHHHHccHHHHHHccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHHTTcEEEEccccGGGTHHHHHHHHHHHHTTcccccEEEEEcTTTTTTccccTTcHTcEEEEccccEEEEcccHHHHHHHHHHHccEEEEccccHHHHHHHHHHHHHHTcGGGTTccccEEEEEcGGGHHHHHHHHHHHHHHTcTTGGGGc DISOP:02AL 1-3| PSIPRED ccccHHHHHHccccccccccHHHHHccccHHHHHHcHHHHHHHcccccHHHHHHHHccccHHHHHHHHccccEEccccccccHHHHccccccEEEEEEccHHHHccccEEEEEcccccHHHHHHHHHHHHHHHccEEEEccccccHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHHcccEEEEcccccccccccHHHHHHHHHHHHcEEEEEEccccccHHHHHHHHHHccccEEEEccccccHHccccHHHHHcccEEEccHHHHHHHccc //