[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : dtxR
DDBJ      :dtxR         iron-dependent transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  49/68 : Bacteria  253/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.76.1b.34.1
:216 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->215 3hrsA PDBj 8e-68 57.9 %
:RPS:PDB   1->215 1c0wB PDBj 1e-14 25.9 %
:RPS:SCOP  2->52 1on1A1  a.4.5.24 * 5e-12 27.5 %
:RPS:SCOP  62->137 1b1bA2  a.76.1.1 * 9e-25 39.5 %
:RPS:SCOP  142->215 1bi0A3  b.34.1.2 * 9e-09 17.4 %
:HMM:SCOP  1->61 1on2A1 a.4.5.24 * 9.1e-13 32.8 %
:HMM:SCOP  62->137 1g3sA2 a.76.1.1 * 2.4e-23 51.3 %
:HMM:SCOP  133->215 1fx7A3 b.34.1.2 * 0.00097 18.3 %
:RPS:PFM   1->51 PF01325 * Fe_dep_repress 2e-08 39.2 %
:RPS:PFM   62->126 PF02742 * Fe_dep_repr_C 2e-15 53.8 %
:HMM:PFM   62->132 PF02742 * Fe_dep_repr_C 5.2e-30 54.9 71/71  
:HMM:PFM   2->51 PF01325 * Fe_dep_repress 1e-15 32.0 50/60  
:HMM:PFM   143->213 PF04023 * FeoA 7.1e-05 22.5 71/74  
:BLT:SWISS 6->215 DTXR_CORDI 2e-16 27.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55247.1 GT:GENE dtxR GT:PRODUCT iron-dependent transcriptional regulator GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1489037..1489687 GB:FROM 1489037 GB:TO 1489687 GB:DIRECTION + GB:GENE dtxR GB:PRODUCT iron-dependent transcriptional regulator GB:NOTE identified by match to protein family HMM PF01047; match to protein family HMM PF01325; match to protein family HMM PF02742; match to protein family HMM PF04023 GB:PROTEIN_ID ACF55247.1 GB:DB_XREF GI:194356799 GB:GENE:GENE dtxR LENGTH 216 SQ:AASEQ MTPNKEDYLKCIYEIGIDLHKITNKEIAARMQVSPPAVTEMIKRMKSENLILKDKECGYLLTDLGLKLVSELYRKHRLIEVFLVHHLDYTSDQIHEEAEVLEHTVSDLFVERLDKLLGFPKTCPHGGTIPAKGELLVEINNLPLADIKEAGAYRLTRVHDSFDILHYLDKHSLHIGDQLQVKQFDGFSNTFTILSNDEDLQVNIDIAKQLYVEKIN GT:EXON 1|1-216:0| BL:SWS:NREP 1 BL:SWS:REP 6->215|DTXR_CORDI|2e-16|27.5|207/226| BL:PDB:NREP 1 BL:PDB:REP 2->215|3hrsA|8e-68|57.9|214/214| RP:PDB:NREP 1 RP:PDB:REP 1->215|1c0wB|1e-14|25.9|212/219| RP:PFM:NREP 2 RP:PFM:REP 1->51|PF01325|2e-08|39.2|51/59|Fe_dep_repress| RP:PFM:REP 62->126|PF02742|2e-15|53.8|65/68|Fe_dep_repr_C| HM:PFM:NREP 3 HM:PFM:REP 62->132|PF02742|5.2e-30|54.9|71/71|Fe_dep_repr_C| HM:PFM:REP 2->51|PF01325|1e-15|32.0|50/60|Fe_dep_repress| HM:PFM:REP 143->213|PF04023|7.1e-05|22.5|71/74|FeoA| GO:PFM:NREP 6 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01325|IPR001367| GO:PFM GO:0005506|"GO:iron ion binding"|PF01325|IPR001367| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01325|IPR001367| GO:PFM GO:0003700|"GO:transcription factor activity"|PF02742|IPR001367| GO:PFM GO:0005506|"GO:iron ion binding"|PF02742|IPR001367| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF02742|IPR001367| RP:SCP:NREP 3 RP:SCP:REP 2->52|1on1A1|5e-12|27.5|51/56|a.4.5.24| RP:SCP:REP 62->137|1b1bA2|9e-25|39.5|76/76|a.76.1.1| RP:SCP:REP 142->215|1bi0A3|9e-09|17.4|69/77|b.34.1.2| HM:SCP:REP 1->61|1on2A1|9.1e-13|32.8|61/0|a.4.5.24|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 62->137|1g3sA2|2.4e-23|51.3|76/0|a.76.1.1|1/1|Iron-dependent repressor protein, dimerization domain| HM:SCP:REP 133->215|1fx7A3|0.00097|18.3|82/0|b.34.1.2|1/1|C-terminal domain of transcriptional repressors| OP:NHOMO 383 OP:NHOMOORG 302 OP:PATTERN --1--11111111112-1------1111231211211111111-1----1111-1111111111--11 1-1-132233422322122-221122222222222222231111222122223233-21111111211212-----------1-------------1--111111131-2----------------1-1-----1123322---11-------------------------------------21111---21111111-111111--1-111111111111111-----111111111111111111111111-2-11-1---11111111----1111111111111111111111111111111112111111---1111---12111-----1---111------2----11----------------11-----------1--------------------------1--1---1--1----------------2------------------------------------------------------------------------------------------------------------------------------------11--11------------------------2----------------------------------------------------------------------------1--------------------------------------1111111111111111---------------------------------------------------------------------------------------------1----------------------------------------------111-----------------------------------11- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 215 STR:RPRED 99.5 SQ:SECSTR cccHHHHHHHHHHHHHHTTccccHHHHHHHTTccHHHHHHHHHHHHHTTcEEEcTTccEEEcHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHTTTccHHHHHHHHHHcccccccTTccccccHHHHTEHHHHcccccEEEEEEEEcHHHHHcHHHHHHHHHTTccTTcEEEEEEETTEcccEEEEccccEEEccTTTGGGEEEccc# DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccccccccEEEccccccHHHcccccEEEEEEEEccHHHHHHHHHcccccccEEEEEEEcccccEEEEEEccEEEEccHHHHcccccEEcc //