[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : eda
DDBJ      :eda          2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  472/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
c.1.10
:209 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->173 1wa3D PDBj 9e-34 41.6 %
:RPS:PDB   14->186 3ceuA PDBj 8e-09 13.0 %
:RPS:SCOP  1->206 1euaA  c.1.10.1 * 4e-44 25.6 %
:HMM:SCOP  1->211 1euaA_ c.1.10.1 * 9e-56 38.5 %
:RPS:PFM   7->186 PF01081 * Aldolase 3e-40 50.8 %
:HMM:PFM   9->200 PF01081 * Aldolase 1.4e-40 31.2 189/196  
:BLT:SWISS 10->192 ALKH_BACSU 5e-30 35.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55443.1 GT:GENE eda GT:PRODUCT 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(279303..279932) GB:FROM 279303 GB:TO 279932 GB:DIRECTION - GB:GENE eda GB:PRODUCT 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase GB:NOTE identified by match to protein family HMM PF01081; match to protein family HMM TIGR01182 GB:PROTEIN_ID ACF55443.1 GB:DB_XREF GI:194356995 GB:GENE:GENE eda LENGTH 209 SQ:AASEQ MTKSDTIIELKKQKIVAVIRGNTKEEGLQASIACIKGGIKAIEIAYTNQYAGQIIKELVDLYQDDQSVCIGAGTVLDAVTARDAILAGANYVVSPSFHAETAKMCNLYSTPYIPGCITLTEITTALEAGSEIIKLFPGSTLSPAYISAVKAPIPQVSVMVTGGVGLNNIPQWFAAGADAVGIGGELNKLASQGNFDRISEIAQQYITLR GT:EXON 1|1-209:0| BL:SWS:NREP 1 BL:SWS:REP 10->192|ALKH_BACSU|5e-30|35.2|179/196| BL:PDB:NREP 1 BL:PDB:REP 11->173|1wa3D|9e-34|41.6|161/203| RP:PDB:NREP 1 RP:PDB:REP 14->186|3ceuA|8e-09|13.0|161/193| RP:PFM:NREP 1 RP:PFM:REP 7->186|PF01081|3e-40|50.8|177/194|Aldolase| HM:PFM:NREP 1 HM:PFM:REP 9->200|PF01081|1.4e-40|31.2|189/196|Aldolase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01081|IPR000887| GO:PFM GO:0008152|"GO:metabolic process"|PF01081|IPR000887| RP:SCP:NREP 1 RP:SCP:REP 1->206|1euaA|4e-44|25.6|203/213|c.1.10.1| HM:SCP:REP 1->211|1euaA_|9e-56|38.5|208/0|c.1.10.1|1/1|Aldolase| OP:NHOMO 716 OP:NHOMOORG 491 OP:PATTERN ------------------------1--1112------------------------------------- 1-1-2-----1--------------3------------341--2211-1---122--1--1--1-12131--------2---1-----111111-----1-2-211-2-1-----------------------------------1111111-1111-111--11111111-11---------12-1111-1-1-------1-------212211----13-2-----1---2------------------113-1-22-----1---23------1112122222---111111211111111111211111-22---222211-231111111-1-21--11111--1--1------------124-1------2221-11-131211--------11121211112-11-1111221--222222211122212112232133122--------1--11----------------------------------122-----1222222211112222111112222-1-1--2221-----123221---1111-1111111-----------------------------------2-----------1-1-1111111-------1142-11-3221211111111111-11111-------------22111212112233222-12224232221323323333232111221222122212-111231111111--111111111111----1111111111-113111312-111--1111111111---4122221-12111111222----------224411111132351122222122-111------------------11----1------1-------------------111-1-1- ------1-----------------------------------------------------------------------------------------------------2------------------------------------------------------1--------------11111--2--1--111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 207 STR:RPRED 99.0 SQ:SECSTR #cHHHHHHHHHHHEEEEEccccccTTHHHHHHHHHHTTccEEEEccccccHHHHHHHHHHccGGGGGGEEEcccTTHHHHTTcEEEcccccccccTTcccEEEEGccTTccEEEEEccHHHHHTTGGGccEEEcccccccccHHHHHHHHHTTcccTTEEEccccTTTHHHHHHTTccEEEEcHHHHHHHTcccccEEEEccHHHHHH# DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHccccEEEcccccHHHHHHHHHccccEEcccccHHHHHHHHHccccEEEEcccccccHHHHHHHHHHcccccEEEEccccHHHHHHHHHccccEEEEcHHHHHHHHHccHHHHHHHHHHHHccc //