[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : exoA
DDBJ      :exoA         exodeoxyribonuclease III
Swiss-Prot:EXOA_STRR6   RecName: Full=Exodeoxyribonuclease;         EC=3.1.11.2;

Homologs  Archaea  28/68 : Bacteria  690/915 : Eukaryota  142/199 : Viruses  0/175   --->[See Alignment]
d.151.1
:275 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->271 2o3cB PDBj 1e-47 42.1 %
:RPS:PDB   1->275 1e9nA PDBj 8e-35 37.8 %
:RPS:SCOP  1->275 1bixA  d.151.1.1 * 2e-69 39.1 %
:HMM:SCOP  1->275 1akoA_ d.151.1.1 * 7.9e-56 35.5 %
:HMM:PFM   1->272 PF03372 * Exo_endo_phos 3e-38 21.7 263/276  
:BLT:SWISS 1->275 EXOA_STRR6 e-161 100.0 %
:PROS 37->46|PS00726|AP_NUCLEASE_F1_1
:PROS 207->223|PS00727|AP_NUCLEASE_F1_2
:PROS 234->245|PS00728|AP_NUCLEASE_F1_3

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56114.1 GT:GENE exoA GT:PRODUCT exodeoxyribonuclease III GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1666839..1667666 GB:FROM 1666839 GB:TO 1667666 GB:DIRECTION + GB:GENE exoA GB:PRODUCT exodeoxyribonuclease III GB:NOTE identified by match to protein family HMM PF03372; match to protein family HMM TIGR00195; match to protein family HMM TIGR00633 GB:PROTEIN_ID ACF56114.1 GB:DB_XREF GI:194357666 GB:GENE:GENE exoA LENGTH 275 SQ:AASEQ MKLISWNIDSLNAALTSDSARAKLSQEVLQTLVAENADIIAIQETKLSAKGPTKKHVEILEELFPGYENTWRSSQEPARKGYAGTMFLYKKELTPTISFPEIGAPSTMDLEGRIITLEFDAFFVTQVYTPNAGDGLKRLEERQVWDAKYAEYLAELDKEKPVLATGDYNVAHNEIDLANPASNRRSPGFTDEERAGFTNLLATGFTDTFRHVHGDVPERYTWWAQRSKTSKINNTGWRIDYWLTSNRIADKVTKSDMIDSGARQDHTPIVLEIDL GT:EXON 1|1-275:0| SW:ID EXOA_STRR6 SW:DE RecName: Full=Exodeoxyribonuclease; EC=3.1.11.2; SW:GN Name=exoA; OrderedLocusNames=spr1660; SW:KW Complete proteome; Cytoplasm; Exonuclease; Hydrolase; Magnesium;Metal-binding; Nuclease. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->275|EXOA_STRR6|e-161|100.0|275/275| GO:SWS:NREP 5 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0004527|"GO:exonuclease activity"|Exonuclease| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0004518|"GO:nuclease activity"|Nuclease| PROS 37->46|PS00726|AP_NUCLEASE_F1_1|PDOC00598| PROS 207->223|PS00727|AP_NUCLEASE_F1_2|PDOC00598| PROS 234->245|PS00728|AP_NUCLEASE_F1_3|PDOC00598| BL:PDB:NREP 1 BL:PDB:REP 1->271|2o3cB|1e-47|42.1|252/280| RP:PDB:NREP 1 RP:PDB:REP 1->275|1e9nA|8e-35|37.8|254/274| HM:PFM:NREP 1 HM:PFM:REP 1->272|PF03372|3e-38|21.7|263/276|Exo_endo_phos| RP:SCP:NREP 1 RP:SCP:REP 1->275|1bixA|2e-69|39.1|256/275|d.151.1.1| HM:SCP:REP 1->275|1akoA_|7.9e-56|35.5|251/268|d.151.1.1|1/1|DNase I-like| OP:NHOMO 1136 OP:NHOMOORG 860 OP:PATTERN ------1111111111-1-----1--------1-1---111112---1-1111--------111---- -11-11-1222-1-1------1---1------11111233----2122121221111111--1112111121111111111-------11111111---212112223-2---------------11-111-1-11----------11-11111111111-1111111111111-11111-11221----11-1111111-1-1-111-1----1111---11--11111111--------------------1211111121211221111111111111111111111111111111111111111111111211111111-1111111111111111---11111111--1--1111-1-1----1-11-1-111112-11111222111122121111111111----1--1--22111111112212231-2---1-1111---222222222222-111112-111---342122122221221111111-1-222222222222222222233222222223322312222223222122222222222222222222222112211111111111111-----1-1-111121-111111111111111111111--11111--11211111------111111-1111-11--21112------11--1111111111111-1111111111111111111111111-11111111111111111111111111-111111111111---11111122222-2221111111111111111111111---22221221222211231111111111111111111111111113223233222222211111111111111111111-------------------------------------11 12--111-211111--1111111111111-111-1-1-1-1-1111--111---11111-11---------------------------1121111-----11111-2312141111122111114121453-11111112113211-1-1--11-11222211121211122122121J433113333-422121211 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 275 STR:RPRED 100.0 SQ:SECSTR EEEEEEEcccHcHHHHHcHHHHHHHTTHHHHHHHHcccEEEEEcccccGGGccTHHHHccGcGGGcccEEEEEcccccccccccEEEEEcccccEEcEEEEccccGGGcccccEEEEEccccEEEEEEcccccGGGTTHHHHHHHHHHHHHHHHHHHHHccEEEEEEccccccGGGccccGGGTTcTTccHHHHHHHHHHHHHTcEEHHHHHcTTccccccEEccGGGGTTTTTcEEccEEEEEcGGGGGGEEEEEEcTTccccccccEEEEEcc PSIPRED cEEEEEEccccccccccccHHHHHHHHHHHHHHHccccEEEEEEEEcccccccHHHHHHHHHHccccEEEEEcccccccccccEEEEEEccccccEEEEccccccHHcccccEEEEEEcccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccHHHcccHHHHcccccccHHHHHHHHHHHHccHHHHHHHHcccccccEEEcccccccccccccccEEEEEEEcHHHHHHHEEEEEEccccccccccEEEEEEc //