[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : fabD
DDBJ      :fabD         malonyl CoA-acyl carrier protein transacylase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  848/915 : Eukaryota  164/199 : Viruses  0/175   --->[See Alignment]
c.19.1d.358.1
:306 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->300 3ezoA PDBj 8e-63 46.1 %
:RPS:PDB   3->305 3eenA PDBj 3e-81 42.2 %
:RPS:SCOP  5->258 1nm2A1  c.19.1.1 * 3e-56 18.8 %
:RPS:SCOP  244->281 2hh8A1  d.358.1.1 * 1e-04 7.9 %
:HMM:SCOP  2->305 1nm2A1 c.19.1.1 * 1.6e-70 49.6 %
:RPS:PFM   5->285 PF00698 * Acyl_transf_1 6e-48 42.6 %
:HMM:PFM   6->287 PF00698 * Acyl_transf_1 4.1e-43 30.5 272/318  
:BLT:SWISS 1->300 FABD_BACSU 1e-71 47.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56237.1 GT:GENE fabD GT:PRODUCT malonyl CoA-acyl carrier protein transacylase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 377858..378778 GB:FROM 377858 GB:TO 378778 GB:DIRECTION + GB:GENE fabD GB:PRODUCT malonyl CoA-acyl carrier protein transacylase GB:NOTE identified by match to protein family HMM PF00698; match to protein family HMM TIGR00128 GB:PROTEIN_ID ACF56237.1 GB:DB_XREF GI:194357789 GB:GENE:GENE fabD LENGTH 306 SQ:AASEQ MTKTAFLFAGQGAQYLGMGRDFYDQYPIVKETIDRASQVLGYDLRYLIDTEEDKLNQTRYTQPAILATSVAIYRLLQEKGYQPDMVAGLSLGEYSALVASGALDFEDAVALVAKRGAYMEEAAPADSGKMVAVLNTPVEVIEEACQKASELGVVTPANYNTPAQIVIAGEVVAVDRAVELLQEAGAKRLIPLKVSGPFHTALLEPASQKLAETLAQVSFSDFTCPLVGNTEAAVMQKEDIAQLLTRQVKEPVRFYESIGVMQEAGISNFIEIGPGKVLSGFVKKIDQTAHLAHVEDQASLVALLEK GT:EXON 1|1-306:0| BL:SWS:NREP 1 BL:SWS:REP 1->300|FABD_BACSU|1e-71|47.7|300/317| BL:PDB:NREP 1 BL:PDB:REP 3->300|3ezoA|8e-63|46.1|297/307| RP:PDB:NREP 1 RP:PDB:REP 3->305|3eenA|3e-81|42.2|303/314| RP:PFM:NREP 1 RP:PFM:REP 5->285|PF00698|6e-48|42.6|272/297|Acyl_transf_1| HM:PFM:NREP 1 HM:PFM:REP 6->287|PF00698|4.1e-43|30.5|272/318|Acyl_transf_1| RP:SCP:NREP 2 RP:SCP:REP 5->258|1nm2A1|3e-56|18.8|234/243|c.19.1.1| RP:SCP:REP 244->281|2hh8A1|1e-04|7.9|38/127|d.358.1.1| HM:SCP:REP 2->305|1nm2A1|1.6e-70|49.6|236/254|c.19.1.1|1/1|FabD/lysophospholipase-like| OP:NHOMO 2646 OP:NHOMOORG 1012 OP:PATTERN -------------------------------------------------------------------- 2241A-211131-1888AA-A977L5A9AAA8A87862351H6B-1111111211--311GC11N2IP7M21-------111211111111111111--111111611121111111111111111111111111111122111F2373355811111111112117A9R311111111111111111111117111111113111111111144112111211111111131111111111111111111111-111111-1-1111111111111111111111132111111111111111111111111111111111111122111111111171441111112--1111111211111111111211124111111111433111122411111111111111-224232222211233511211122141213121111122111111111221121111111111111111111111111111111111111111111333266666411238888272121211112231121122113323111111111111112121111321111331111112324216132212N811111111111111111111111111122111-132111322222322222222222221-11111111---71421211115155211-2111112122222111111213327331211111111111111111111111123333323323211112222221122161111111111111111122222122114322232522112222534211111111111131111111211222222211111111111--------------1-1-------------------------1111111111141 1132ir2-1---11168D6N9GINUSP222333HK87868888444FEFLFDCA79PFC7771121---1--1-2------1111111--A18211----1-4111-163O54433-2---22221-313A3-314111-2-2511221-3114263212112771-121C32571122H222221133D2111-1113 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 305 STR:RPRED 99.7 SQ:SECSTR TEEEEEEEccTTcccTTTTHHHHHHcTHHHHHHHHHHHHHTccHHHHHHccHHHHTcHHHHHHHHHHHHHHHHHHHHHTccEEEEEEEcTTHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHccTTcEEEEEEEcccHHHHHHHHHHHHTTccEEEEEEEETTEEEEEEEHHHHHHHHHHHHTTTcccEEEccccccTTcGGGHHHHHHHHHHHTTccccccccccEETTTTEEcccHHHHHHHHHHHHccEEHHHHHHHHHHTTccEEEEcccccHHHHHHHHHcTTcEEEEcccHHHHHHHHH# PSIPRED ccEEEEEEccccccHHHHHHHHHHHcHHHHHHHHHHHHHccccHHHHccccHHHcccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHccccccEEEEEEcccccEEEEccHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHHcccccccEEEEEEccccccccHHHHHHHHHHHHHccccHHHHHHHHHHccccEEEEccccHHHHHHHHHHHccccccccccHHHHHHHHcc //