[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : fabG
DDBJ      :fabG         3-oxoacyl-[acyl-carrier protein] reductase
Swiss-Prot:             

Homologs  Archaea  56/68 : Bacteria  880/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:243 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->241 2p68A PDBj 2e-60 46.5 %
:RPS:PDB   3->243 1dohB PDBj 8e-49 27.5 %
:RPS:SCOP  10->243 1pwxA  c.2.1.2 * 1e-53 21.8 %
:HMM:SCOP  1->240 1zemA1 c.2.1.2 * 5.7e-85 45.8 %
:RPS:PFM   10->170 PF00106 * adh_short 5e-26 47.2 %
:HMM:PFM   7->171 PF00106 * adh_short 9.4e-47 35.4 161/167  
:BLT:SWISS 3->243 FABG_BACSU 2e-61 48.1 %
:PROS 140->168|PS00061|ADH_SHORT

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56221.1 GT:GENE fabG GT:PRODUCT 3-oxoacyl-[acyl-carrier protein] reductase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 378812..379543 GB:FROM 378812 GB:TO 379543 GB:DIRECTION + GB:GENE fabG GB:PRODUCT 3-oxoacyl-[acyl-carrier protein] reductase GB:NOTE identified by match to protein family HMM PF00106; match to protein family HMM PF07993; match to protein family HMM PF08659; match to protein family HMM TIGR01830 GB:PROTEIN_ID ACF56221.1 GB:DB_XREF GI:194357773 GB:GENE:GENE fabG LENGTH 243 SQ:AASEQ MKLEHKNIFITGSSRGIGLAIAHKFAQAGANIVLNSRGAISEELLAEFSNYGIKVVPISGDVSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTEADFEKVLKVNLTGAFNMTQSVLKPMMKAREGAIINMSSVVGLMGNIGQANYAASKAGLIGFTKSVAREVASRNIRVNVIAPGMIESDMTAILSDKIKEATLAQIPMKEFGQAEQVADLTVFLAGQDYLTGQVVAIDGGLSM GT:EXON 1|1-243:0| BL:SWS:NREP 1 BL:SWS:REP 3->243|FABG_BACSU|2e-61|48.1|241/246| PROS 140->168|PS00061|ADH_SHORT|PDOC00060| BL:PDB:NREP 1 BL:PDB:REP 1->241|2p68A|2e-60|46.5|241/248| RP:PDB:NREP 1 RP:PDB:REP 3->243|1dohB|8e-49|27.5|240/271| RP:PFM:NREP 1 RP:PFM:REP 10->170|PF00106|5e-26|47.2|161/169|adh_short| HM:PFM:NREP 1 HM:PFM:REP 7->171|PF00106|9.4e-47|35.4|161/167|adh_short| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00106|IPR002198| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00106|IPR002198| RP:SCP:NREP 1 RP:SCP:REP 10->243|1pwxA|1e-53|21.8|229/252|c.2.1.2| HM:SCP:REP 1->240|1zemA1|5.7e-85|45.8|240/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 23079 OP:NHOMOORG 1132 OP:PATTERN 2221246BCACABAA819354321D66B9B8D22---------21154--722-25223244954156 MNj6*61899HAB6***XY-X*66**YXYYXq********7*I*bOHC4KF3WMTD6J11SPg7VRjnraG211142322B9a12433A9A72A331--C7g6KI*GkBQ111111111111115A97DH976CBBLJJNP222NEPEMKBA96633433864494GOHlB433454354446LFBCD881IAYIIJIJNILIKLKNNKRISSJTJLLBHIRQNHA999A8Rr977777657777776DBBDEA3D2BD26232DH55AA99A7CE99777878784545555556555557667778777774773327779535DE6665555657E56628A77431199322C8123325333366554I2M*RRd12212XI*xy88ElYddVMOONLMOMOOc-QTfRP*Qcj*q2*wwV*r******flMXKRXdVNSXPLSEEEEEEEEXWWHAFJF33323111111222332231222121112DN**XCNrfUp******baabWss**fffeEa*i*i**s4AacTOFOLLeOkT*uBMH6EAFFA233222278ERMAAUAI422212433427B96G6595BDGDag354544255336435344444473536A9GEAEILIFSGAACDCFBHEDBBAGBEEBAI1-3656B111111FKLO8OBGJJGGFFFHH-JHHIIEFGHGJFIGGGHGGUdWOFCECDABCCDDCDDCBCBCDaFFCFEDF51CEEEFEEDEFGE111A67556IKHJ6LRTO232939222223464UWVZXEPBHERDabXXRbgpUSRZVRYUUC776687674889I98998FFABCPRQPROLFGH96763376JJCBCC--------1-4----2-1-3-1------3-------55432666763G4 2233jdQ-E841BHL***v*v*v****XZNRRTWXUVeXZWaaRROxrx*****mytYYZTXIGSABC6J98QHP68578CKKKQLBD-g*X*PuNMMNKLENXSN1OiM*z*gltbJGLGRnPvmGjI**m-gdsPOLGnNVnXFSJHIg9EaRdWp***eR*lgXmWl*Qlxp9IH8*686JiTmm*s*VLKuUdaH ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 243 STR:RPRED 100.0 SQ:SECSTR TccTTcEEEETTTTcHHHHHHHHHHHHTTcEEEEEEccHHHHHHHHHHHHTTccEEEEEccTTcHHHHHHHHHHHHHHHccccEEEEcccccccccGGGccHHHHHHHHHHHTHHHHHHHHHHHHHHccTTcEEEEEccGGGTcccccccHHHHHHHHHHHHHHHHHHHHHGGGTcEEEEEEEcccccHHHHHHGGHHHHHHHHccTTcccccHHHHHHHHHHHHcGGTccccEEEEcccccc DISOP:02AL 1-1| PSIPRED ccccccEEEEEccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHHccccEEEEcccccccccHHHccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccEEEEEccHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccHHHcccHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccEEEEcccccc //